KEGG   Paenarthrobacter aurescens: AAur_0874Help
Entry
AAur_0874         CDS       T00447                                 

Gene name
rbsA
Definition
(GenBank) ribose ABC transporter, ATP-binding protein
  KO
K10441  ribose transport system ATP-binding protein [EC:3.6.3.17]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau02010  ABC transporters
Module
aau_M00212  Ribose transport system
Brite
KEGG Orthology (KO) [BR:aau00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    AAur_0874 (rbsA)
Enzymes [BR:aau01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     AAur_0874 (rbsA)
Transporters [BR:aau02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212] [OT]
    AAur_0874 (rbsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_13
Motif
Other DBs
NCBI-ProteinID: ABM09160
UniProt: A1R357
Position
919521..921050
Genome map
AA seq 509 aa AA seqDB search
MSILSTGPAPLNGGSLTEEPNALKGIGLTKQYGGNTVLHGVDITLRAGTVLGFIGENGAG
KSTLSSILAGIKSPDAGEMFLNGLPYAPTGPASALNSGVAIIHQEIKMVPRLSVAENMFL
GRWPKKRGRVDTTSMAEQAEAALAVLGAKINPRRAVAGLSMAAQQEIEIAKAILRDPSYV
IFDEPSASLGQEETEKVLDQIRVLRDRGAGVIYISHRLDEISAIADEILCLRDGHRAMAW
ETGEVSKDQMIRAMVGREFVYAHEAPKPAEPDVVLEVKNLARQGVFSDISFSVRKGEILG
LSGLVGAGRTEVVRTLAGADRADAGTIAVDGKPVKISNVASAIRQGIFMVPEDRKGQGLN
LGRSGGENMVLPWEKTLTPSGFVSNRTVKRVEREQAQELDIRGNLDIPVLFLSGGNQQKV
LLAKWLVRKPKVLILDEPTRGVDVGAKAAIYEIVRKLAASGVAIIVVSSELEEVLGLSHR
VLVMAGGQQRGILNREEALPDRVMELSVP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatcctgagcacgggaccggcccctctcaacggaggatcgctgaccgaggagccc
aacgccctcaagggcattggcctcaccaaacagtacggcggcaacactgtgctgcatgga
gtggacatcaccctgagagcaggcacggttcttggattcatcggggaaaatggcgcaggt
aaatccaccctgagctccatactggcaggcatcaagtctccagatgccggagagatgttc
ctgaatgggcttccctacgcccctacaggcccggcttctgcgctaaacagcggggtggcc
attattcaccaggaaatcaagatggtcccgcggctaagcgttgccgaaaacatgtttctg
gggcggtggccgaaaaaacggggccgcgtggacacgacttccatggctgagcaagccgag
gcagccttggccgttttgggagccaagatcaacccgcgtcgggcagttgccggactctcc
atggcggcgcagcaggaaatagagatcgcaaaagccatcctgcgggatccgtcctacgtg
atcttcgacgaaccatcagcttctttgggacaggaggaaacggagaaggtcctcgatcaa
atccgggtacttcgtgaccggggtgcgggcgtcatttacatcagccatcgcctggatgaa
atttcggctattgctgacgaaattctttgcctccgtgatgggcacagagctatggcatgg
gagacgggcgaagtcagcaaggaccagatgatccgcgccatggtgggccgcgagttcgtt
tacgcgcacgaagctccgaagccggctgagccggatgtcgtgttggaggtcaagaacctg
gctcgtcagggagtcttcagcgatatctctttctctgtgcgcaagggggagatccttggg
ctgtccggccttgtaggagcaggccgcaccgaagttgtcaggacccttgccggtgccgat
cgtgccgacgcgggcaccatcgcggtggacggcaagcccgtgaagatcagcaacgttgcc
agtgccattcgacaaggcattttcatggttcctgaggaccgcaaaggccaagggctgaac
ttgggcaggagcggaggagagaacatggtcctgccgtgggaaaaaacgctgacccccagc
ggattcgtgtccaacaggacagtgaagcgcgtggagcgagagcaggcccaggagttggat
atccgagggaacctggacattcctgtcctttttctctctggaggaaaccagcagaaagtc
ctgttggcgaagtggctggtccggaaaccaaaggtcctcatcctcgacgagcccacgcgt
ggagtggatgttggtgcaaaggccgccatctatgaaattgtccgcaagctggccgcttcc
ggggtggccatcattgttgtttcttccgaactcgaagaggttctcggcctctcgcaccgt
gtactcgtcatggcgggagggcagcagcgcggaatcctcaaccgcgaggaagccctcccg
gaccgggtcatggaactctcagtgccctag

DBGET integrated database retrieval system