KEGG   Paenarthrobacter aurescens: AAur_0879Help
Entry
AAur_0879         CDS       T00447                                 

Definition
(GenBank) putative transmembrane efflux protein (MFS)
  KO
K19577  MFS transporter, DHA1 family, inner membrane transport protein
Organism
aau  Paenarthrobacter aurescens
Brite
KEGG Orthology (KO) [BR:aau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aau02000]
    AAur_0879
Transporters [BR:aau02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    AAur_0879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_4
Motif
Other DBs
NCBI-ProteinID: ABM06966
UniProt: A1R362
Position
complement(924964..926202)
Genome map
AA seq 412 aa AA seqDB search
MPIGLIALALGGFGIGLTEFVIMGLLPEVASDFAVSEATAGWLISGYALAVVVGALLLTL
AMSRMDRKAALALLLGVFVIGNVLSALAPDYWTMMAGRIIAALAHGAFFGIGSVVAAGMV
DRAKKAAAIAIMFTGLTAANVLGVPFGTMLGQAAGWRSTFWAISVIGILALIGILTLVPR
TTNIDSTPSSGLRGELSAFKSGQVWLSIAVTILGYGGMFGAFTYIAFTLTEISHFPAATV
PWLLILFGVGLFVGNALGGKAADRNVDRALLVVLSVLLVVLVVFALTADNQPLAIMSLVL
MGGFGFATVPGLQMRVMTYAKSAPTLASGANIGAFNVGNALGAWLGGVTITAGLGYTSPI
WAGAAITLLGLIVMVFAATAARRAAQRMTQSGDEQSMVQPTSEKQSLAGSPL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcccattgggctaatagccttggccttgggaggctttggcatcgggcttacagagttc
gtcatcatgggacttctacccgaggtcgcatcagatttcgccgtgagcgaggcgaccgcg
ggctggttgatatctggatacgccctggccgtggtggttggggcattgctgctaaccctg
gcaatgtcacgcatggaccggaaggcggcccttgccttactcctcggagtcttcgtcata
ggaaacgtcctgtcggcactggccccggactactggaccatgatggctggacggatcatt
gcagccctcgcgcacggagccttctttggtatcggatcggtggtagcggcgggcatggtg
gaccgcgccaagaaggccgctgccattgccatcatgttcaccggcctgaccgctgccaac
gtcctgggagtgccattcggcaccatgctgggacaagcagcgggctggcgctccactttc
tgggccatcagcgtcatcggcattcttgccctgattggaatcctgaccctggtgccgcgc
accacaaacatcgattccactccatcctcaggtcttcgcggcgaactcagcgcgttcaag
tcgggccaggtttggctgtccatcgccgtcaccatcctgggatacggcggaatgttcgga
gcctttacttacattgccttcacgctgaccgagatctcgcacttcccagccgcaaccgta
ccttggctgctgatcctcttcggcgttggactcttcgtgggtaacgcccttggaggaaag
gccgctgaccgcaacgtcgaccgggccttgctggttgtcctgtccgtgctgctggtagtt
ctggtggtgttcgctttgaccgcggacaaccagcccctcgccatcatgtcattggtactc
atgggcggcttcggctttgccaccgtccccgggctgcagatgcgcgtcatgacgtacgca
aagagcgcccccaccctagcgtccggggccaacatcggcgcattcaacgtgggcaacgcc
ctgggagcctggctaggcggcgtcaccattacggcaggcctgggctacacatcccccatt
tgggcaggtgctgccatcacacttcttggcctcatcgtcatggtgttcgctgcaacggcc
gcccgtcgcgccgctcagcgaatgacgcagtccggcgatgagcagtccatggtgcagcca
acatccgagaagcagtccctcgcaggatctccgctctag

DBGET integrated database retrieval system