KEGG   Paenarthrobacter aurescens: AAur_0988Help
Entry
AAur_0988         CDS       T00447                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00260  Glycine, serine and threonine metabolism
aau00630  Glyoxylate and dicarboxylate metabolism
aau00670  One carbon pool by folate
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
aau01130  Biosynthesis of antibiotics
aau01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AAur_0988 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AAur_0988 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AAur_0988 (gcvT)
Enzymes [BR:aau01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     AAur_0988 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: ABM07023
UniProt: A1R3G6
Position
1045926..1047059
Genome map
AA seq 377 aa AA seqDB search
MTENYTALYEEHKKLGASFTDFGGWQMPLKYSSELAEHHAVRKSAGLFDLSHMGEVWVTG
PEAAAFLDYALVGKISAMADGKAKYSLICQEDGGIIDDLITYRRGSEKFLVVPNAGNAKV
VATALLERAAGFDVEVQDASAETSLIAVQGPLAEAILLRLVPVEQHALVTELKYYAAVEV
PFTFDGGTQDLLLARTGYTGEDGFEIFVANDSAAALWQAIAGAAEEGELTPAGLASRDSL
RLEAGMPLYGNELSREGNPFAAGLGPVVALSKEGDFVGKDALAALKADGAGSTSGRKLVG
LKGLGRRAGRGHYPVLKDGAVVGEVTSGQPSPTLGYPVALAYVDVEHSELGTALDIDLRG
KSEPFEVVALPFYKRVR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaactacacagctctctacgaagagcacaagaagctcggcgcgtccttcacc
gacttcggcggctggcagatgccgctcaagtactcgtccgagttggccgagcaccacgca
gtccgcaagtccgccggcctgttcgacctctcccacatgggtgaagtctgggtcaccggt
cccgaggcagccgcgttcctcgactacgccttggtgggcaagatctccgccatggccgac
ggtaaagcaaagtactcgctgatctgccaggaagacggcggcatcatcgatgacctcatc
acctaccgccgcggctccgagaagttcctggtggtcccgaacgcgggcaacgcgaaggtt
gtggccacggcgttactggagcgggcggccgggttcgacgtcgaggtccaggacgcatcc
gctgaaacctcgctgatcgcggtgcagggtcccctcgccgaagcgatcctcctccgcttg
gtgcccgtcgagcagcatgcgctggtcaccgaactcaagtactacgcggcggtcgaagta
ccgttcacgttcgacggcggcacgcaagacttgctgctcgcccgcaccggttacaccggg
gaagacggcttcgagatcttcgtagccaacgactccgctgcagccctctggcaggccatc
gccggcgccgctgaagaaggcgaactgacccccgccggcctggcttcacgcgactccctg
cgtctcgaagccgggatgcccctctacggcaacgaactctcccgtgaaggcaaccccttc
gcggcaggactcggacccgtagtggcactgtccaaggaaggtgacttcgtcggcaaggac
gcactcgctgccctcaaagctgacggtgccggctccaccagcggacgcaagctcgttggc
ctcaaaggcctgggccgcagggccggtcgcggccactacccggtcctcaaagacggcgcc
gtggttggcgaagtcacctccggtcagcccagccccacgctcggctacccggtagcgttg
gcgtacgtcgacgtcgaacactcagagcttggtaccgcactggacatcgacctgcgcggt
aagagtgagccgttcgaagtcgtcgcactgccgttctacaagcgggttcgctga

DBGET integrated database retrieval system