KEGG   Paenarthrobacter aurescens: AAur_1139Help
Entry
AAur_1139         CDS       T00447                                 

Definition
(GenBank) beta-D-xylosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00460  Cyanoamino acid metabolism
aau00500  Starch and sucrose metabolism
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AAur_1139
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AAur_1139
Enzymes [BR:aau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     AAur_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like DUF11
Motif
Other DBs
NCBI-ProteinID: ABM09599
UniProt: A1R3W5
Position
complement(1212450..1214807)
Genome map
AA seq 785 aa AA seqDB search
MSTGAADQQALARISASDVVEHLIREMTLEEKLAQLVGVWVNASTDGNSVAPLQSQMAGD
TRSWDDIIANGLGQITRMYGTVPVEPSEGARRLAAAQEQIMAASRFGIPAQVHEECLAGL
AAWKATAFPVPLAWGATFNPVLVREMASRIGATMRSLGIHQGLAPVLDVVRDLRWGRVEE
TIGEDPYLVGTVATAYVQGLETTGIVATLKHFVGYSASQAGRNHAPVSMGPRELADVMLP
PFEMAIRHGAARSVMHAYTDVDGVPAAANRALLTGLLREDWGFAGTVVADYFGVAFLDIT
HGVAADSGDAAVLALSAGVDVELPTVNCFGEPLLRRIRDGVLDESVVDEALRRVLTQKAE
VGLLSPDFSAVPPVLSGSSEAGPIELDSSEYRALAREVAAQSLVLLSNRKFREAPALPLE
PVGSLAVVGPLADDPFAMLGCYSFDAHVGASHPEVPMGISVPSVAAVAAGRYGSVLSSVT
GNCESATDEQIAEACRVASGVDTCVVVVGDNAGLFGRGTSGEGNDAADLRLPGDQHRMLD
RVLSACEASGTRAVVVVLSGRPYALGDFVDRAHAIVQGFFPGEEGGEALWDVLTGVVNPS
GKLPVSVPQSSGGQPGTYLHSKLAGPSGVSALDPSPLFGFGHGLSYTTFELSDHQRSAPT
MSTSDSVVVSCSVTNTGSRAGAEVVQLYLTDPVGEVVRPVRELIGYARVELEAGQSVVVD
FVVHADRTSFTGLDLKRVVTSGLVKLHVSTSSVSDVASHEVILHGPRRVVGFEREMLTPV
EVRQR
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccggcgccgccgatcagcaagcacttgcccgcatatccgcatcggacgtcgtg
gagcacctcatccgtgaaatgacccttgaggaaaagctcgcgcaactggtgggagtgtgg
gtcaacgcatccactgacggcaattccgtggctcccttgcaaagccagatggccggtgac
acgcgttcttgggatgacatcatcgccaacggactcgggcagatcactcgcatgtacggc
accgtccccgtggaaccctccgaaggcgcgcgccgcctggccgcagcccaggaacagatc
atggccgcctcccgcttcggaataccagcgcaggttcacgaggaatgcctggccggtctg
gctgcctggaaggccacggccttccctgtaccactcgcctggggcgctaccttcaaccct
gtgttggtgcgggaaatggcatcccgtatcggagcgaccatgcggtccttgggcattcac
caaggtttggcccccgtcctggacgtggtccgcgatctccgttggggccgggtggaggaa
accatcggcgaagacccgtatttggtgggcacggtggccaccgcgtacgtgcagggcctg
gaaaccaccggaatcgtggccaccctcaagcacttcgtgggctactcagcttcccaggcg
ggccgcaaccacgcgcccgtctccatgggcccccgagaactcgccgacgtcatgctgccg
ccgtttgaaatggcgatccgccacggggccgcgcgttcggtgatgcacgcttacaccgac
gtcgatggcgtaccggccgccgcgaaccgcgcccttctcaccgggctgcttcgtgaggac
tggggcttcgccgggacggtagtggccgactacttcggcgtcgcgttcctggacatcacc
cacggagtagccgctgactccggtgacgctgccgtgctggcgctgtccgcaggcgttgac
gtggaattgcctactgtgaactgctttggtgagccgctgctgcgtcgtatccgcgacgga
gtactggacgaatccgtggttgacgaggcactgcgacgggtccttacgcagaaggctgag
gttgggctgttgtcgcccgacttctcggccgttcctccggtgctgtccggtagtagtgag
gctggtccgattgagttggattcctccgagtaccgtgcgttggcgcgagaggtggccgcc
cagtctctggtgttgttgagcaacaggaagttccgtgaggctccggccctgccactcgaa
ccggtgggctccctggcagttgtgggtccgttggccgacgaccccttcgccatgctcggc
tgctactccttcgacgcccacgttggtgcgtcgcatcccgaggtgccgatgggtatctct
gttccttcagtcgcggccgttgcagctgggcggtacggatctgtgctcagctcagtcacc
ggtaattgcgaatcggccacggacgagcagattgccgaagcttgccgtgtagcgtccggc
gtggacacctgtgtggtggtggtcggcgacaacgccggactgtttggccggggcacctcg
ggcgaaggcaacgacgccgcggacctccgcctccccggcgaccagcaccggatgctggac
cgtgttctctctgcatgcgaggcgtccgggactcgtgccgtggtggtggttctcagcggg
cgaccctacgcactgggcgactttgttgaccgggcacacgcgatcgtccaaggcttcttc
cccggcgaagaaggtggcgaggcactctgggatgtgctgaccggcgtcgtgaatccttcc
ggcaagttgcctgtctcggtgccccaatcctccggtggccagccaggcacgtaccttcat
tccaagctcgccggtcccagcggggtcagcgcgctggacccctcgccgctgttcggtttc
gggcacggcctttcctatacgacgtttgagctgtccgatcaccagcgcagtgcgccgacg
atgtcgacgtcggactcggtggttgtgagttgctctgtgacgaatactggttcgcgtgct
ggcgctgaagttgtccagctgtacctgacggacccggtgggcgaagtggttcgtcccgtc
cgcgagttgattggctacgcccgcgtcgaactggaagccggccaatccgtcgtcgtggat
tttgtggttcacgcggaccgcacgtccttcaccgggctggaccttaagcgcgtggtgacg
tcagggctggtgaagctgcacgtttccacgtccagcgtgtccgatgttgcttcgcatgag
gtcatcctgcacgggccgcgacgagttgtggggttcgagcgggagatgctgacgccggtg
gaggtgcggcagcgctaa

DBGET integrated database retrieval system