KEGG   Paenarthrobacter aurescens: AAur_1475Help
Entry
AAur_1475         CDS       T00447                                 

Gene name
metX
Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00270  Cysteine and methionine metabolism
aau00920  Sulfur metabolism
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
aau01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aau00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AAur_1475 (metX)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AAur_1475 (metX)
Enzymes [BR:aau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     AAur_1475 (metX)
    2.3.1.46  homoserine O-succinyltransferase
     AAur_1475 (metX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Esterase Hydrolase_4 DUF4884
Motif
Other DBs
NCBI-ProteinID: ABM09150
UniProt: A1R4T7
Position
1618469..1619590
Genome map
AA seq 373 aa AA seqDB search
MTITATALPKSGEEDGIVKYAGIGPLELEAGGFLPDVVLAYETWGQLNSDASNAVLVQHA
LTGSTHVARGATDEEGWWEQLVGPGATIDTNKFFVISINIVGGCYGSTGPSSAAPDGKPW
GSRFPLVTLRDSTVAESRLADALGIDSWHAVLGGSMGGARALEWAVTFPERVERCAVISV
GAYSTAEQIAFAQAQTLAIRQDPNFNHGDYYGGTAPEHGLALARRIAHITYRSALELDFR
FGRQAQHQETPLAAAVLGERGRYQVESYLDHQGTKLVRRFDANSYIAITEALMSHDVTRG
RGTLEAALSRTKAEFFVAAVDSDRLYFPAQSRELAAALPGDVSVHLIEAPIGHDGFLTEI
GQLSAQLREAFFG
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaccattactgctacagcccttccaaaatccggagaagaagacggaatcgtcaagtac
gccggcatagggccgctggaacttgaagccggcggattccttcccgacgttgtccttgcg
tacgagacctgggggcagctgaactccgacgcatccaatgccgtactcgtccagcacgcg
ctcacgggcagtacacacgtagcccgcggcgccactgatgaagaaggctggtgggagcaa
cttgttggaccaggtgccaccatcgacaccaacaagttcttcgtcatctccatcaacatc
gtgggcggctgttacggcagcaccggcccatcatcagcagcacccgatggcaagccctgg
ggttctcgtttcccgttggtcactctgcgcgacagcacggtggctgagtcacgccttgcc
gatgctttgggcatcgactcctggcacgccgtattgggtgggtcgatgggcggcgcccgt
gcgctcgagtgggccgtgacgttccccgagcgggtggagcgctgcgccgtgatctcggtg
ggcgcctacagcacggccgagcagattgccttcgcgcaggcccaaacccttgccatccgg
caggacccgaacttcaatcacggcgactactacggtggtaccgcgcctgagcatggtttg
gcgttggcccgacgtatcgcccacatcacttaccgctcagcgttggagttggacttccgc
ttcggccggcaagcccagcaccaggagacgccgctggcagctgctgtgctgggggagcgc
gggcgctaccaagtggaaagctacctggaccaccaggggacaaagctggtccgccgtttc
gatgccaacagctacatcgccattaccgaggccttgatgtcccatgacgtcactcgtggt
cgcggcacgttggaagcggcattgtcgcgcaccaaggctgagttctttgtggcggccgtg
gacagcgacaggctctatttcccggcacagtcgcgggaactcgccgcggcactcccggga
gacgtatcggtccacctcattgaggcgccgattggacacgatggcttcctcaccgagatc
ggccagctctcggcgcagctccgcgaagccttcttcggctaa

DBGET integrated database retrieval system