KEGG   Paenarthrobacter aurescens: AAur_2138Help
Entry
AAur_2138         CDS       T00447                                 

Definition
(GenBank) putative acyl-CoA oxidase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00071  Fatty acid degradation
aau00410  beta-Alanine metabolism
aau00592  alpha-Linolenic acid metabolism
aau00640  Propanoate metabolism
aau01040  Biosynthesis of unsaturated fatty acids
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
aau01200  Carbon metabolism
aau01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AAur_2138
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AAur_2138
   00592 alpha-Linolenic acid metabolism
    AAur_2138
   01040 Biosynthesis of unsaturated fatty acids
    AAur_2138
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AAur_2138
Enzymes [BR:aau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     AAur_2138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_ox_N LcrG
Motif
Other DBs
NCBI-ProteinID: ABM09402
UniProt: A1R6M0
Position
complement(2352999..2355104)
Genome map
AA seq 701 aa AA seqDB search
MTEVVDRASSANQPSGRDDAATPSAAEPVVDVAALGEQLLGKWAHIRHQARAVAGNPAVQ
KIEGLHHTEHRARVFEQLKFLVDNNTVHRAFPTRLGGSDDHGGNIAGFEEIVTADPSLQI
KAGVQWGLFGSAVMHLGTVEHQDKWLPGIMSLEIPGCFAMTETGHGSDVASIATTATYDE
ASQEFVINTPFRAAWKDYIGNAANDGLAAVVFAQLITKNVNHGVHAFYVELRDPATKEFL
PGIGGEDDGIKGGLNGIDNGRLHFANVRIPRTNLLNRYGDVAVDGTYSSTIESPGRRFFT
MLGTLVQGRVSLDGAAVAASKVALKTAIQYATERRQFNASSSTDEEVLLDYQRHQRRLFT
RLATTYAASFAHEQLLQKFDDVFSGAHDTDADRQDLETLAAALKPLSTWHALDTLQECRE
ACGGAGFLIENRFASLRADLDVYVTFEGDNTVLLQLVAKRLLADYAKEFRSADFGVLARY
VVDQAAGVALHRTGLRQVAQFVADTGSVQKAALALRDEEGQRTLLADRVQSMVAEVGAAL
KGANKLPQHQAAALFNQHQHELIEAAQAHAELLQWEAFTEALGHVSDEGTKRVLTWLRDL
FGLSLIEKHLSWYLMNGRLSMQRGRTVGTYINRLLVKIRPHAVDLVDAFGYGPEHLRASI
ASGAEAVRQDEAREHFSEQRASGSGPADEKTLLALKVRKSR
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtagtggaccgggcctcatcggccaaccagccctcaggccgcgacgacgca
gccacgcccagcgctgccgagcctgtggtggatgtcgctgccctgggagagcagctcctg
ggcaagtgggcccacatccggcaccaagcccgcgcggtggcaggcaacccggcggtccag
aaaatcgagggcctgcaccacaccgagcaccgtgcccgagtgttcgagcagctgaagttc
ctggtggacaacaacaccgtccatcgcgccttccccacccggctgggcggctccgacgac
cacggcggcaacatcgccggcttcgaagagatcgtcaccgccgacccgtcgctgcagatc
aaggctggcgtccagtggggcctcttcggctctgcagtgatgcacctcggcaccgtggaa
catcaggacaagtggctccccggcatcatgagccttgagattccaggctgcttcgccatg
accgagacgggccacggctcggatgtcgccagcattgccaccacggctacctacgacgaa
gccagccaggaattcgtgatcaatacgccgttccgggcggcatggaaggactacatcggc
aatgcagccaacgatggcctggccgctgtggtgtttgcccaactgatcaccaagaacgtg
aatcacggtgtccacgctttctacgtggaactccgcgatccagccaccaaggagttcctc
ccgggcatcggcggtgaagatgacggcatcaagggtggactgaacggcattgacaacggc
cggttgcactttgcgaatgtacgcatcccccgcaccaacctcctgaaccgctacggtgac
gtcgctgtggacggtacttactcctccaccattgaaagcccgggacgccgcttcttcacg
atgctcggcaccttggttcaaggccgtgtttccctggatggagccgctgtggctgccagc
aaagttgccctcaagaccgccattcagtatgccactgagcgccggcaattcaacgcgtcg
tccagcaccgatgaagaggtcctgctggactaccagcggcaccagcgccgcctgttcacc
cggctcgccaccacgtacgccgccagtttcgcgcacgaacagttgttgcagaagttcgac
gacgtcttctccggcgcccacgacaccgatgccgaccgccaggacctggaaaccctggcc
gccgcgctcaaaccgctcagcacctggcatgccctggacacattgcaggaatgccgggag
gcatgcggcggcgcaggcttcctgatcgagaaccgctttgcttccttgcgagcggacctg
gacgtctatgtaaccttcgaaggcgataacactgtcctgctccaactggtggccaagcgc
ctcttggccgattacgccaaggaattccgcagcgcggactttggcgtactggcccgctac
gttgtggaccaggcggccggggtggctctgcaccgtacgggtctaaggcaggtggcccag
ttcgtggccgataccggttcagtccaaaaggctgctttggcgttgcgggatgaggaaggc
cagcggaccctcctcgcagaccgcgtgcagtcgatggtggcagaagtcggtgcggcactg
aagggcgccaacaagctcccccagcaccaggctgcagccctcttcaaccagcaccaacac
gaactcatcgaagcggcccaggcgcacgccgaactcctccagtgggaagccttcactgag
gctctgggccacgtctctgatgaagggaccaagcgggtcctgacgtggctgcgcgacctc
ttcgggctgtccctgatcgagaagcacctgtcctggtacctcatgaacgggcgtctttcg
atgcagcggggccggaccgtgggtacgtacatcaaccgcttgctggtcaagatccgcccg
cacgccgtggacctcgtggatgctttcggctacggtcccgagcatctgcgtgcttccata
gcgagcggtgcagaagccgtcaggcaggatgaagcccgcgagcacttcagcgagcagcgg
gccagcggaagcggccctgcagacgagaaaacgctccttgccctgaaggtccgcaagtcg
cgttag

DBGET integrated database retrieval system