KEGG   Paenarthrobacter aurescens: AAur_2503Help
Entry
AAur_2503         CDS       T00447                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00450  Selenocompound metabolism
aau00970  Aminoacyl-tRNA biosynthesis
aau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AAur_2503 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AAur_2503 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aau01007]
    AAur_2503 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aau03016]
    AAur_2503 (metG)
Enzymes [BR:aau01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AAur_2503 (metG)
Amino acid related enzymes [BR:aau01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AAur_2503 (metG)
Transfer RNA biogenesis [BR:aau03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AAur_2503 (metG)
 Prokaryotic type
   Other AARSs
    AAur_2503 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ABM08451
UniProt: A1R7L5
Position
complement(2748514..2750073)
Genome map
AA seq 519 aa AA seqDB search
MTSPEKSPFYITTAISYPNGVPHIGHAYEVIATDAMARFKRLDGHEVFFMTGTDEHGLKM
QQSAEKEGLTAKQLADRNSAAFKQMSQDLGISHDRFIRTTDQDHYAASQAIWKKMEANGD
IYLSKYEGWYSVRDEAYYVEDDTVVKDDGLRYSKETDTLVTWTAEESYFFRLSNYQDKLL
ALYEEQPEFGAPQSRFNEVISFVRRGLEDLSISRTTFDWGVPVPGDEKHVMYVWVDALTN
YLTGVGYPDIESESFKKFWPADVHVIGKDISRFHAIYWPAFLMSAGLELPKRVMIHGFLT
NNGVKMSKSLGNVVAPQDFVAQYGLDQCRYFFLREVPFGADGNYNHEAIVGRMNSDLANN
FGNLAQRSLSMVAKNCEGRVPEPGEFTAEDKALLAQAGELLDTARAAFDKQEFSRALEAI
WTVLGDTNAYFAEQAPWVLRKTDLERMNTVLYVTLEVVRIVAILAQPVMPSSSAKLLEVL
GQPEGESRQFAAVATPIVAGTELPAPAPVFPRYEEPAEA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtctccagagaaatccccgttctacatcaccaccgcaatcagctaccccaatggc
gtgccgcacatcggccacgcctacgaggtcatcgcgactgatgccatggcgcgcttcaag
cgccttgacggccatgaggtgttcttcatgaccggaacggatgagcacggactcaaaatg
cagcagtcagccgagaaagaaggcctcactgccaagcagctcgctgaccgcaattcggcc
gccttcaagcagatgagccaggacttgggcatctcccatgaccgcttcatccgcaccacg
gatcaggaccattacgccgcttcccaagccatctggaagaagatggaagccaacggcgat
atctacctgtccaagtacgagggctggtactccgtccgcgacgaggcctactacgtcgaa
gacgacaccgtggtgaaggatgacgggctccgctactccaaggagacggacaccctggtc
acctggacggccgaggaaagctacttcttccggctctcgaactaccaggacaaactgctt
gccctgtacgaggaacagcctgagttcggcgcgccgcaatcccgcttcaacgaggtcatc
agcttcgtcaggcgcggcttggaggacctgtccatcagccgcaccaccttcgactggggc
gtcccggttccgggcgacgagaagcacgtcatgtacgtctgggttgacgcactcaccaac
tacctgaccggcgtcggctacccggacatcgagtcggaatccttcaagaagttctggccc
gccgacgtccacgttatcggcaaggacatctcccgcttccacgctatctactggcccgct
ttcctcatgagcgccgggctggaactgcccaaacgggtcatgattcatggcttcctcacc
aacaacggtgtgaagatgtccaaatccctgggcaacgttgtggcaccgcaggacttcgtc
gcccagtacggcctggaccagtgccgctacttcttcctccgcgaagttcctttcggggcg
gatggcaactacaaccacgaggccatcgtggggcgtatgaattcggatctggccaacaac
ttcggcaacctcgcccagcgttcgctgtccatggttgcgaagaactgcgagggcagggtt
cccgaacccggagagttcacggcagaggacaaagccttgctggcacaggccggtgagctg
ctggacaccgcacgtgccgcgttcgacaagcaggaattcagcagggcactcgaggccatc
tggactgttttgggcgacaccaatgcctacttcgcagagcaggctccgtgggtgctgcgc
aagaccgatctggaacgtatgaacacggtcctgtacgtcaccttggaagttgtccgcatc
gtggcgatcctcgctcagccggtcatgccgtcgtcgtccgcgaagctcctggaagttctc
ggacagccggaaggcgagtcgcgtcaattcgcggctgtcgccacaccgattgttgccggc
accgaattgcccgcgcctgcgccggtcttcccgcgctacgaggaacccgccgaggcttag

DBGET integrated database retrieval system