KEGG   Paenarthrobacter aurescens: AAur_2754Help
Entry
AAur_2754         CDS       T00447                                 

Gene name
hemG
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00860  Porphyrin and chlorophyll metabolism
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AAur_2754 (hemG)
Enzymes [BR:aau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     AAur_2754 (hemG)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     AAur_2754 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO HI0933_like Pyr_redox_2 Thi4 FAD_binding_3 FAD_binding_2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ABM07215
UniProt: A1R8A4
Position
complement(3035626..3037098)
Genome map
AA seq 490 aa AA seqDB search
MRRGHTKPEAHDSRPTAVVVGGGISGLIASRELAADGWAVTVLEASNAWGGCVGSHVVAG
LQLDSGAESFATRSTAVADLARELGLADRIVAPHPGGAWVQLPSGPQELPKTGVLGIPAN
PWDPEVRRSLGLAGAMRASLDRWLPASVGTSSDVTSVSSLVRTRMGKRVLERLVSPVVGG
VHSADPALLDVDMVAPGLRAGLRAHGSLAAAVAAQRRTATASTASGPAKAGSAVAGLKGG
MNTLVVALVSDLRERGVSLLTGKRAEDVVKTEDGWRVTAGNDTYDADRLVVALDGPAAVG
LLEKSLPELSSLRPAPGPLVSLVTMVVDLPQLDGRPRGTGILVAPETPGIKAKALTHATA
KWDWLADEAGPGTHVLRLSYGRREEAGGGADLVLDDESLLAAALEDASALLTVRVSRSDI
VDWDVVRWAGALPFAAVGHKQRVAQVRKVCAAADGLTMVGGWLAGNGLAAVVADTRAQLA
AVSANGPSIA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagggggcacacaaagcccgaggcacatgattcacggccaacagccgtggtggtt
ggcggaggcatctcgggcctgatcgcctcacgtgaactggcggcggacggttgggcggtc
actgtcctcgaagcaagcaacgcttggggcggctgcgtgggaagccatgttgttgccggg
ctgcagctggacagcggggcggagtcgttcgccacccggtccacagctgtagccgacctc
gcgcgtgagcttggactggcggaccgcatcgtcgccccgcatccgggtggcgcctgggta
cagcttcccagcggtccgcaggagctccccaaaacgggggtgctcgggattcctgcgaac
ccctgggaccctgaagttcggcgatccttggggctcgcgggtgcaatgagggcatccttg
gaccgttggctcccggcctctgtgggaacgtcctcggacgtcaccagcgtttcctctttg
gtccgaacccggatgggcaaaagagttcttgaacggcttgtttctccggtggtgggtggc
gttcactctgccgaccctgccctcttggacgtggacatggtcgccccggggctgcgcgcg
gggctccgcgcccatggatccctcgctgccgctgttgcggctcaacgcagaacggctacc
gcatctacggcgtccggcccggcgaaggcgggttccgccgtcgcgggcttgaagggtggg
atgaataccctggtggtcgcgctggtatcggacttgcgggagcgcggggtgtcattgctg
accggcaagcgtgccgaggacgtcgtcaagacggaagacggttggcgggtcaccgccgga
aacgacacgtacgacgccgaccggctggtggttgcgcttgacggcccagccgccgttggg
ctgctggagaagtcgctacctgagttgtccagcctgcgtcccgcccccgggccgctggtg
agcctggtgacgatggttgtggatttgccgcagcttgacggcaggccacgggggacaggg
atcctggtggctcctgagacccctgggatcaaggccaaagccttgacgcatgcaacggca
aagtgggattggttggctgacgaggctggtcccggaacgcatgtcctgcgcctttcctat
ggtcggcgcgaagaggcgggtggtggagcggacctcgtactggatgatgagtctctcctg
gccgccgccttggaagacgcttccgcgctgttgaccgttcgggtatcccggtcggacatc
gtggactgggatgtggtgcggtgggcgggcgcattgccgttcgccgccgtcggtcataaa
cagcgtgtggcgcaagtgcgcaaggtgtgcgccgctgcggacggtctgaccatggtgggc
ggctggttggccggaaacggccttgccgcagtagtggctgatacgcgggcgcaacttgcc
gcggtaagcgccaacggaccatccattgcgtga

DBGET integrated database retrieval system