KEGG   Paenarthrobacter aurescens: AAur_2821Help
Entry
AAur_2821         CDS       T00447                                 

Gene name
bgaC
Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AAur_2821 (bgaC)
Enzymes [BR:aau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AAur_2821 (bgaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5 Cellulase
Motif
Other DBs
NCBI-ProteinID: ABM07872
UniProt: A1R8G9
Position
complement(3102381..3104177)
Genome map
AA seq 598 aa AA seqDB search
MNNALLSYHDAVLYRSGEPYRILAGAIHYFRVHPDLWQDRLRRLKAMGANTVDTYVAWNF
HQPKRDEAPDFSGWRDLGRFMDLAAEEGLDVIVRPGPYICAEWDNGGFPSCLTGIPGIGL
RCMDPVFTAAIEEWFDHLLPIVASRQTSAGGPVVAVQIENEYGSYGDDHEYIRWNRRALE
ERGITELLFTADGGTDYFLDGGAVEGTWATATLGSRGDEAVATWQRRRPGEPFFNVEFWG
GWFDHWGEHHHGRDAEDAALEARKMLDLGGSLCAYMAHGGTNFGLRSGSNHDGTMLQPTV
TSYDSDAPIAENGALTPKFHAFRKEFYRAQGVDDLPELPAALLADAPVLPAQSLPLSPGP
ELLELVRDAGKPVSSVKPLSFEQLGLDGGMVLYSSEAILPGRPDAPTESRLKITGLNDRA
YVWVDGTFAGVLDDVNGSEGLPVTGTGIAAKLEILVENLGRINYGPLTGHGKGILGGVLV
NQRYTFHWRQTPVDLAEWGPEDLEGLAGSDFEVGEPADTFIALPDSGKGFVWLNGFLLGR
YWEKGPQVTLYAPAPLLKAGRNSIKVLELGKPGTVVELREAPDLGPEEAGPIKAAELP
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaacgccctgctgagctaccacgacgccgtcctttaccgttcgggtgaaccgtat
cgcatcctcgccggagccatccactacttccgtgtgcacccggacctgtggcaggaccgg
ctgcgtcggctcaaggcgatgggcgccaacacggtggacacgtacgttgcttggaacttc
caccagcctaagcgcgacgaagctccggacttcagcggctggcgggacttgggccggttc
atggacctcgcagcagaggaagggctggacgtcatcgtccgccccgggccctacatttgt
gccgagtgggacaacggcggcttcccctcatgtctgacaggcattcccggcatcggcctt
cggtgcatggacccggtgttcaccgctgccatcgaggagtggttcgatcacttgcttccc
atcgtcgcctcacggcagacctccgcgggtggtccggtggtggcggtgcaaatcgagaac
gaatacggcagctacggcgacgaccacgagtacattcgctggaaccggcgcgcgctggag
gagcgcggtatcactgaactccttttcacagcagacggcggcacggactacttcctcgac
ggcggcgcggtggaaggcacgtgggcgacagcgacgttgggaagccgcggcgacgaagcg
gtagctacatggcagcgacgccggcccggcgagccgttcttcaacgttgagttttggggt
ggctggttcgaccactggggcgaacaccatcacgggcgggatgcagaagacgccgcattg
gaagcacgcaagatgctggatctgggcggttcactctgtgcctacatggcccacggcgga
accaactttggcctccgctccggcagtaaccacgatggcaccatgcttcagcccacggtc
accagctatgactcggatgcacccatcgctgagaacggcgccctgactcccaagtttcat
gccttccgtaaggagttctaccgggcacagggcgttgacgacctgcccgaacttccagct
gccttgctggcagacgcgccggtactcccggcgcagtccctgccgttgagccccggaccg
gagctgctggagctcgtcagagacgccggcaagccggtcagcagcgtcaaaccgctcagt
ttcgaacaactgggactcgacggcggcatggtcctctactcctccgaagccatactgccg
ggccgtcccgatgcccccacagagagccggttgaagatcaccggcctcaatgatcgtgcc
tacgtttgggtggacggcacctttgccggtgtcctggacgacgtcaacggctctgaagga
ctgcctgtcacgggcaccggcatcgctgccaagctcgaaatcctcgtggaaaacctcggc
cgcatcaattacggcccgctgaccggtcacggcaagggaatcctgggcggcgtcctcgtc
aatcagcgctacaccttccactggaggcagacacctgttgacctcgcagagtggggtccg
gaagacctggagggactggcaggaagtgactttgaggtgggggaaccagccgacaccttc
attgccttgcccgattccgggaagggcttcgtttggctgaacggcttccttttgggcagg
tactgggagaagggcccgcaggttaccctctacgcacccgctccgttgctcaaagccggc
cgcaacagcatcaaggtgctggaactcgggaagccggggaccgtcgtcgaacttcgcgag
gcgcctgacctaggtcccgaagaagcgggtccgatcaaggcggccgaacttccgtaa

DBGET integrated database retrieval system