KEGG   Paenarthrobacter aurescens: AAur_3154Help
Entry
AAur_3154         CDS       T00447                                 

Definition
(GenBank) pyruvate dehydrogenase E2 (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00010  Glycolysis / Gluconeogenesis
aau00020  Citrate cycle (TCA cycle)
aau00620  Pyruvate metabolism
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
aau01120  Microbial metabolism in diverse environments
aau01130  Biosynthesis of antibiotics
aau01200  Carbon metabolism
Module
aau_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAur_3154
   00020 Citrate cycle (TCA cycle)
    AAur_3154
   00620 Pyruvate metabolism
    AAur_3154
Enzymes [BR:aau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AAur_3154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H RnfC_N HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ABM09916
UniProt: A1R9E2
Position
complement(3454359..3455840)
Genome map
AA seq 493 aa AA seqDB search
MSSDMQVFKLPDLGEGLTEAELVNWLVAVGDEIVVDQPIAEVETAKSMVEVPSPYAGTVA
ELHGEAGQTLDVGKPLISIARAGSAAGSPAAAPVPAPAGSVDPSPVSSGLDVSSAVEAAA
ETYRTEEKAGSGNVLIGYGTPGGATGGRTRPRKASASVVASAVAEPAAVPEMEPAVAGTR
IPGKLSAVISPLVRKMARDHGVSLDAIEGSGASGLIMRRDVEAVIASPSVAAEPSVAAIP
AAPLSAPASAGAVDSRTGLSVSARTPVRGVRKAVAANMTRSRSEIPEATVWVDVDATALL
DMRAELKKRAPYDTPGLLAFIARFVTAGLKKYPALNTRFETASDGSQEIVGFEGINLGFA
AQTDRGLVVPSVRNAHELSARELDAEIRRLTAVARDGKATPTELGSGTFTLNNYGVFGVD
GSAAIINYPEVAMLGVGRIIDKPWVVNGELAVRKVTELTLAFDHRVCDGETAAGFLRYVA
DAIENPGGALADM
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagttcagatatgcaggtcttcaaactgcccgatcttggggagggcctcaccgaggcc
gaactggtgaactggctcgtcgccgtgggtgacgagattgtggttgaccagcccattgcc
gaggttgagaccgccaagtccatggttgaggtgccctcgccttacgccggcaccgtcgcc
gagttgcacggtgaagccggtcaaacgctcgacgtcggcaagccgctgatctcgatcgct
cgcgctggttccgccgccggttcgcccgctgccgctcctgttcctgctccggctggttct
gtggacccatcgccggtgtcctcgggtcttgacgtttcgtccgccgtggaagctgctgcc
gagacgtaccggaccgaggaaaaggcaggctcgggcaatgtgctgattggttacggtacg
cccgggggagccaccggtggccggacccggccgcggaaggcgagtgcttctgttgttgct
tctgctgttgctgagcctgctgctgtgccagagatggagccggctgtggccggaacgcgc
atcccgggcaagctcagtgccgtcatctctccgcttgtccgcaaaatggcacgcgaccac
ggtgtttccctcgacgctattgagggctcgggcgccagcggactgatcatgcgcagggac
gtggaggctgttattgcttcgccctcggttgctgctgagccttctgttgctgccattcct
gctgctcccctttctgctcctgcttctgcgggtgccgttgatagccgtaccggtttgtct
gtctccgcccgcacacctgtccgtggagtccgcaaggccgtggccgcgaacatgacccgc
agccgctcggaaatccctgaagccaccgtttgggtggatgtggacgcaacagcgctgctg
gatatgcgggccgagctcaagaagcgcgcaccatacgacacccctggtctgttggccttc
attgcccgttttgtcacggctgggttaaaaaagtacccggccttgaacacgcgctttgaa
accgcttcggatggctcgcaggagatcgtcgggtttgaaggaatcaacctcggcttcgcc
gcccaaaccgaccgcggactcgtagtcccgtccgtgcggaatgcgcatgagctgagtgcc
cgcgaactggacgcagagatccgccgactcaccgccgtcgcacgtgacggaaaggcgacc
cccacggaactgggctcgggcacgttcacgctgaacaactacggtgtgttcggcgtggac
ggctcggccgcgatcatcaactatcccgaggtcgcgatgctgggcgtgggccgcatcatc
gacaagccctgggtagtcaacggcgagcttgccgttcgcaaggtcaccgagctgaccctc
gccttcgaccaccgcgtgtgcgacggcgaaaccgcggccggcttcctccggtacgttgcc
gacgcgatcgagaaccctggcggcgcgctcgcagacatgtaa

DBGET integrated database retrieval system