KEGG   Paenarthrobacter aurescens: AAur_3858Help
Entry
AAur_3858         CDS       T00447                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00051  Fructose and mannose metabolism
aau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AAur_3858 (mtlD)
Enzymes [BR:aau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     AAur_3858 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ABM09759
UniProt: A1RBC4
Position
complement(4232644..4233792)
Genome map
AA seq 382 aa AA seqDB search
MKAVHFGAGNIGRGFVGLLLHEAGYEVVFADVADALISQLASASSYDVHEVGENPAVKTV
SGFRAFNSASQEAAVVEEISTADVLTTAVGPHILKFVAPVIARGLAVRPADLPPLQVMAC
ENAINATDLLHTEIRAAWDDSAGDLDAVAVFANTAVDRIVPNQAPGQGLDVTVETFYEWV
IDRTPFGGNAPKIPGATFVDELGPYIERKLFTVNTGHASAAYFGYAAGLEKISDAMADPA
VAAKVRAVLEETKELLVAKHGFEEAEQEAYVQKILSRFTNPHLPDTVNRVGRAPLRKLSR
HERFVGPAAELAERGVTPAALLEAMSAALRFDDGNDDEAVELTNLLSELDAAAAVERITE
LTPTHPLFPALQKLVEDRQAEA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggcagttcattttggggcaggcaacatcgggcgtggcttcgtggggctgctgctt
cacgaggccggctatgaggtggtgttcgcggatgttgcggacgcgctgatcagccagctc
gcctcggcaagcagctacgacgtccacgaggtgggcgagaacccggcggtcaagaccgtt
agcggcttccgtgccttcaattccgcttcgcaggaagctgctgttgtggaggaaatctcg
acggcggatgtgctcaccactgctgtggggccgcacatcctgaagttcgtggcaccggtg
atcgcccgcgggctggccgtccggcccgcggacttgccaccccttcaggtcatggcctgc
gagaacgccatcaatgccacggacctcctccacacggagatccgggcggcttgggacgac
tccgccggcgacctggacgccgtcgcggtttttgccaacaccgcggtggaccgcatcgtc
cccaaccaggcgccaggccagggcctggacgtcactgtggagacgttctacgagtgggtc
atcgaccgtacgccgttcggcggcaacgccccgaagattcccggagctaccttcgtggac
gagctggggccgtatatcgagcgcaagctgttcacggtgaacaccggccatgcttctgct
gcgtacttcggctacgcagccgggcttgagaagatctccgatgccatggcggatccggct
gtggcagcgaaggtccgggcggtgctggaggaaaccaaggaactgctggtggccaagcac
gggttcgaggaggctgagcaggaagcgtacgtgcagaagatcctttcccgcttcaccaac
ccgcacctgcccgataccgtgaaccgcgtgggccgggcgcctttgcggaagctaagccgg
cacgaacggttcgttggtccggcggcggagttggccgaacgcggcgtcacgccggcggca
ttgcttgaggcaatgtctgcagccctccgtttcgacgacggcaacgacgacgaagccgtg
gaactcaccaacttgctgtccgaactggacgcggctgccgccgtcgaacgaatcacggaa
ctgacgccgacgcacccgctgttcccggcgttgcaaaagctcgtggaggatcggcaggct
gaagcgtaa

DBGET integrated database retrieval system