KEGG   Paenarthrobacter aurescens: AAur_3891Help
Entry
AAur_3891         CDS       T00447                                 

Definition
(GenBank) pyruvate dehydrogenase E2 (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00010  Glycolysis / Gluconeogenesis
aau00020  Citrate cycle (TCA cycle)
aau00620  Pyruvate metabolism
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
aau01120  Microbial metabolism in diverse environments
aau01130  Biosynthesis of antibiotics
aau01200  Carbon metabolism
Module
aau_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAur_3891
   00020 Citrate cycle (TCA cycle)
    AAur_3891
   00620 Pyruvate metabolism
    AAur_3891
Enzymes [BR:aau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AAur_3891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_D23 GCV_H
Motif
Other DBs
NCBI-ProteinID: ABM08106
UniProt: A1RBF6
Position
complement(4267250..4268815)
Genome map
AA seq 521 aa AA seqDB search
MTVKKFNLPDVGEGLTEAEVVAWKVKPGDVVAINDVLCEIETAKSLVELPSPFAGTVTEL
LVEEGITVEVGTAIIAVSEGQDGDAAPVTPVAPEAPAVEMPLYGKLLVDDEGDDNRPAGG
PLVGSGPKADAVKRRARKRPAGPVVEAATVEENAEGTVQDHQAALEAKAAETPAAHRTTA
AAAGVAPVTQTPAAQAQPVTAEAPQAAASRGAAISGTISGLVNKVLAKPPVRKFARDLGI
DLADVVATGQRGEVTREDLVSYQAQRDAEHDQADSFWGASKKPQDQRVERMPVKGVRKAT
AKAMVDSAFSAPHVSIFVDVDASRTMEFVKRLKVSRDFEGIKVSPLLILAKAVIWAAARN
PSVNATWVDNADGKGGAEIHVKHYMNLGIAAATPRGLMVPNIKDAQDLSLKELALALNEL
ATKARAGKTQPAEMQGGSLTVTNIGALGIDTGTPIINPGEVAIIAFGTIKQKPWVLDGEV
IPRWITTLGGSFDHRVVDGDLSARFMADVASILEEPALLLD
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtaaagaaattcaacctgccggacgttggcgaaggcctgaccgaggccgaggta
gtggcttggaaggtcaagccgggggacgtcgttgccatcaacgatgtcctgtgcgagatc
gagaccgccaagtccctcgttgagctgccctcgcctttcgcaggcactgtcactgagctg
ctggtggaggaaggcatcacagtggaggtcggcacggcgatcatcgctgtttcggaagga
caggatggggatgccgcacccgtgacgccggttgccccggaggcacccgccgtcgagatg
cccctctacggaaagttgctggtcgacgacgaaggcgacgacaaccgtccggcaggcggc
ccgttggtcggttccgggcccaaggctgacgccgtcaaacgccgtgcgcgcaaacgcccg
gctgggccggtggttgaggcagctacggtcgaggagaacgcagaaggtactgtccaggac
caccaagccgcactggaagccaaggcagcagaaactcctgctgcacaccgcacgacggcg
gcagccgccggcgtcgcgcccgtcacccagacgcctgccgctcaagcgcaacccgtcaca
gccgaagcgccgcaggctgctgcctcccgcggtgccgctatcagcggaaccatcagtggt
ctggtcaacaaggtccttgcaaaacctcctgtgcgcaaattcgcccgcgatctgggaatc
gacctcgctgatgtggtggctaccggccaacgcggtgaagtgacccgcgaggacctggtg
agctatcaggcccaacgtgatgctgagcatgaccaagcggacagcttctggggggcgtcc
aagaagccgcaggatcagcgcgtggagcggatgccggtcaagggcgtgcgcaaggccacc
gccaaggccatggtggattcagctttctcggctccgcacgtcagcattttcgtggatgtg
gatgccagcaggaccatggagttcgtcaagcggctgaaggtctcacgcgacttcgaaggc
atcaaggtttcgcccctgctcatcttggccaaagcagtgatttgggccgccgcacgcaac
cccagcgtcaacgcgacgtgggtggacaacgccgatggtaaaggcggcgcggagatccat
gtgaagcactacatgaacctgggaattgccgctgcaactcctcgcggcctcatggtcccc
aacatcaaggatgcccaggatctgtccctgaaggaattggccttggccctcaatgagctg
gcaaccaaggccagggcagggaagacacagccggctgagatgcagggtggaagcctgact
gtcaccaacatcggcgcactcggtattgatacaggaacgcccattatcaacccgggcgaa
gtagccatcattgcgttcggaaccattaagcagaagccttgggtcttggacggcgaggtc
atcccgcgctggatcactactcttggcggttccttcgaccaccgcgtggtggacggtgat
ttgtccgcgcgcttcatggcggacgtggcctccattctcgaagaaccggctctcctgctt
gactga

DBGET integrated database retrieval system