KEGG   Alteromonas australica DE170: EP12_02550Help
Entry
EP12_02550        CDS       T03858                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
aaus  Alteromonas australica DE170
Pathway
aaus00564  Glycerophospholipid metabolism
aaus01100  Metabolic pathways
aaus01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aaus00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EP12_02550
Enzymes [BR:aaus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     EP12_02550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AJP42744
Position
complement(577907..578785)
Genome map
AA seq 292 aa AA seqDB search
MLDWLKVNLQYITPKHLLSRLVGKLAAAELGGFTTFIIKLFIKQYNVNMDEALHSDPGYY
RSFNAFFTRPLKPEARTIDENPSALIHAVDGAVSQFGDIRDDSIFQAKGHDYSLTSLLGG
KPDIAQPFKGGTFATVYLAPRDYHRIHMPIDGTLTDMIYVPGELFSVNPLTAQNIPGLFA
RNERVVAIFDTPVGKMAMVLVGATIVASIETVWAGTVTPPAGKNVQHWQYDKDSEASVKL
KKGDELGRFKLGSTIVACFENQAIDFEPLAPGQVTRLGEPMAYVAGSKELSS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgctggactggcttaaagtaaatctacaatacattacccctaaacatttgttgtctcgc
cttgtaggcaagttggcagcggcagagttgggcggctttaccacattcattatcaaactt
tttattaagcaatataatgtcaatatggatgaggcgctgcactcagatcctggttattac
cgcagttttaatgccttttttactcggccattaaaacccgaagcgcgcacgattgacgaa
aacccttccgcgctcattcacgccgtagacggcgctgtgagtcaatttggcgatattcgt
gatgacagtatttttcaagcgaaggggcatgactatagcctcacaagtctattaggcggt
aaacctgacatcgcccagccatttaaaggcggaactttcgctacggtttacttagcacct
cgagattatcaccgtattcacatgcctattgatggcacgcttaccgacatgatttacgtg
ccgggtgagcttttttctgtcaacccgctaacggcacaaaatattcctggcctgtttgcc
cggaatgagcgcgttgtggctattttcgataccccagtaggtaaaatggcgatggtgctg
gttggagcaaccatagtagcgagcatagaaactgtttgggcaggaaccgtgacgccacca
gcaggcaaaaatgttcaacattggcaatatgacaaagacagcgaagccagcgtgaaattg
aaaaaaggcgatgaattgggccgtttcaaacttggctcgaccattgtagcctgcttcgaa
aaccaagccattgattttgagccattagcgccaggacaagtaacacgattgggtgaaccc
atggcctatgttgctggaagcaaagagctttctagctag

DBGET integrated database retrieval system