KEGG   Alteromonas australica DE170: EP12_03030Help
Entry
EP12_03030        CDS       T03858                                 

Definition
(GenBank) diacylglycerol kinase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
aaus  Alteromonas australica DE170
Pathway
aaus00670  One carbon pool by folate
aaus00790  Folate biosynthesis
aaus01100  Metabolic pathways
Module
aaus_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:aaus00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EP12_03030
   00670 One carbon pool by folate
    EP12_03030
Enzymes [BR:aaus01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     EP12_03030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AJP42820
Position
664807..665301
Genome map
AA seq 164 aa AA seqDB search
MIAAMAHERVIGADNDMPWHLPADLKHFKQITLGKPVVMGRKTYASIGKALPGRPNIVIS
SSTSLQLADADVVSSCDDAIEKAATYLTSDDDEIMIIGGGTLYEAFLARAQTLYLTEIDL
AVDGDTYFPDYHARGEWACTFEERHDADKKNPHRYRFLTFKKKE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgattgctgcaatggcgcatgaacgcgttattggggctgataatgatatgccttggcac
ttgcccgcagatttgaagcactttaagcaaattaccctgggcaaacctgtcgtcatgggg
agaaaaacctatgcctctattggtaaagcgctacctggtaggccgaatattgttatatca
agcagtacgtcactgcagttagcggatgcagacgttgtttcatcttgcgatgatgctatt
gaaaaagcggcaacgtaccttacaagtgacgatgacgaaatcatgattattggagggggg
acgctctatgaagcgttcttagcgagggcacaaacgctgtatttaacggaaattgattta
gccgtagacggggatacttacttccctgattatcatgcacgtggtgaatgggcatgtaca
ttcgaagaaagacacgatgcagacaaaaaaaaccctcatcgctaccggtttttaaccttc
aaaaagaaggagtaa

DBGET integrated database retrieval system