KEGG   Alteromonas australica DE170: EP12_05505Help
Entry
EP12_05505        CDS       T03858                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
aaus  Alteromonas australica DE170
Pathway
aaus00620  Pyruvate metabolism
aaus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EP12_05505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aaus02000]
    EP12_05505
Enzymes [BR:aaus01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     EP12_05505
Transporters [BR:aaus02000]
 Other transporters
  Primary active transporters [TC:3]
   EP12_05505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 GCV_H RnfC_N PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AJP43243
Position
1205204..1206994
Genome map
AA seq 596 aa AA seqDB search
MSKPLALTELVLRDAHQSLLATRMRIEDMLPIAEKLDKAGFWSVESWGGATFDACIRYLG
EDPWERIRQLKAAMPNTKQQMLLRGQNLLGYRHYADDVVTRFVERAHENGVDVFRIFDAM
NDMRNLETAIKATVDCGAHAQGTISYTVSPVHNLQLWLDMAKQLEDMGVHSICVKDMAGL
LKPYDCEALISGLKETVKVPIAMQCHATTGLSTATYQKAIDAGIDMLDTAISSMSMTYGH
TATETMVSIVEGTERDTGLSLPHLEEIASYFREVRKKYSKFEGSLKGVDARILLAQVPGG
MLTNMESQLKEQGAEDKFEEVLKEIPRVREDLGFIPLVTPTSQIVGTQSVLNVLTGERYK
SITKETAGVLKGEYGATAAPVNAELQARVLDGNSPITCRPADNIAPELDSLEKELTALAS
TKSISLSNEKIDDILTYALFPQIGLKFLENRGNPDAFEPAPGQEAPTQVTDTSAASQPTS
GSAAAYDVSVDGKRYHVQVAPSGELTHVAPAPAAPQNASAAAPAGNEQSINAPLAGNVFK
VLVRAGDAVSEGDVVMIIEAMKMETEIRSAFTGTVSDVCVGEGDSITSGQPLIMLG
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagccactggccttaaccgagctagtattgcgtgacgcccatcaatcgctactt
gccacacgtatgcgtattgaggatatgttacctattgctgaaaaattagataaagctggc
ttctggtcagttgaatcgtggggaggcgcaacttttgacgcgtgtattcgttatttagga
gaagatccttgggagcgaatcaggcagttaaaggcggccatgcccaataccaagcaacaa
atgcttttacgcgggcaaaatctattggggtatcgtcattatgctgacgacgtggtgact
cgctttgttgagcgcgctcacgaaaatggggtagatgtttttcgaattttcgatgccatg
aatgacatgcgaaatctcgaaacagcaataaaggcaacagtagactgcggtgcccatgca
caaggaacgatttcctacacggtaagccctgttcacaatctgcaactttggctcgatatg
gctaaacagctggaagacatgggggttcactctatttgtgtgaaagacatggctggcctt
cttaagccttacgattgtgaagccctaattagcggcctaaaggaaacggtgaaggtgcct
attgctatgcagtgtcatgcaaccaccggattaagtacagccacttaccagaaagccatt
gatgctggtatagatatgctggataccgctatctcatcgatgagtatgacctatggtcat
acggcaacagaaaccatggtgtctatagtagaaggtaccgaaagagatacaggtctctct
ttgcctcaccttgaagaaatcgctagttactttagggaagtgcgcaaaaaatacagtaaa
tttgaaggcagcctcaaaggggttgatgctcgaattttattggcgcaagtgccaggtggc
atgttaaccaatatggaaagccagctaaaagagcagggcgctgaagacaagtttgaagaa
gtattgaaagaaattccccgtgtaagagaagatctcggcttcattcctctggtgacaccg
acgtcgcaaattgtgggtacacaatcagtattaaatgtactcactggtgagcgctataag
agtattacgaaagaaacggctggggtccttaaaggtgaatacggtgcgacagcagcgcca
gtcaatgctgaacttcaagcccgcgtgttagatggcaacagcccaataacatgtcgtcca
gccgataatattgcgcctgaattagacagtttagagaaagaacttaccgcactagccagt
acaaaatctatctcattaagcaacgaaaaaattgatgacattctcacctatgctctgttt
cctcaaataggcttaaaatttttggaaaacagaggcaatccagacgcctttgagccagcg
ccagggcaagaggcgccaacgcaagtgacagatacttcagcggcctctcaacctacttct
ggttcagccgcagcgtacgacgtcagtgtggacggaaagcgttatcatgtccaagtggca
ccgtctggtgaactcactcatgttgctccagcaccggctgcgccacaaaatgcgtctgca
gcagcgccagcaggtaacgagcagtcaattaatgcaccgctagcaggaaacgtgtttaaa
gttcttgtgcgtgccggagacgcggtgtcagaaggcgatgtggtcatgattatcgaagcg
atgaaaatggaaactgaaattcgttcagcctttacaggcactgtcagtgatgtgtgtgtg
ggtgaaggcgatagcatcaccagtggtcagcctttgataatgttggggtag

DBGET integrated database retrieval system