KEGG   Alteromonas australica DE170: EP12_08515Help
Entry
EP12_08515        CDS       T03858                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aaus  Alteromonas australica DE170
Pathway
aaus00071  Fatty acid degradation
aaus00072  Synthesis and degradation of ketone bodies
aaus00280  Valine, leucine and isoleucine degradation
aaus00310  Lysine degradation
aaus00362  Benzoate degradation
aaus00380  Tryptophan metabolism
aaus00620  Pyruvate metabolism
aaus00630  Glyoxylate and dicarboxylate metabolism
aaus00640  Propanoate metabolism
aaus00650  Butanoate metabolism
aaus00900  Terpenoid backbone biosynthesis
aaus01100  Metabolic pathways
aaus01110  Biosynthesis of secondary metabolites
aaus01120  Microbial metabolism in diverse environments
aaus01130  Biosynthesis of antibiotics
aaus01200  Carbon metabolism
aaus01212  Fatty acid metabolism
aaus02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aaus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EP12_08515
   00630 Glyoxylate and dicarboxylate metabolism
    EP12_08515
   00640 Propanoate metabolism
    EP12_08515
   00650 Butanoate metabolism
    EP12_08515
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EP12_08515
   00072 Synthesis and degradation of ketone bodies
    EP12_08515
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EP12_08515
   00310 Lysine degradation
    EP12_08515
   00380 Tryptophan metabolism
    EP12_08515
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EP12_08515
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EP12_08515
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EP12_08515
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aaus04147]
    EP12_08515
Enzymes [BR:aaus01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EP12_08515
Exosome [BR:aaus04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EP12_08515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJP43704
Position
1827536..1828711
Genome map
AA seq 391 aa AA seqDB search
MSEESVVIVAAKRTPMGGFNGSLSGVTATDLGATAIKAACESVGGDNIDEVIMGCVLPAG
LGQSPARQASLAAGLPLGAGVTTINKVCGSGLKAVMLAHDLIKAGSATSIVAGGMESMSN
APYLLPKARSGYRMGHGQVLDHMMLDGLENAYDGKAMGCFAQSTADEQNISRGDMDEFAL
SSLSKAHEAINSGGFSDEIVEVTIKTRKGDVVVDTDEGPGNARPEKIPTLRPAFTKDGTV
TAANSSSISDGAAALVVMSESKAAELGLTPLAKVVAHATHSIEPENFTLAPVGAMKKVLE
KANWVKEEVDLFEINEAFAMVTMMAIRQLQLDEKKVNVKGGACALGHPIGASGARILVTL
LHALKQKNARKGIASLCIGGGEGVALAVEML
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagaatctgtagtgatagtggcggctaaacgtacgccaatggggggctttaat
ggctcgttatctggtgttaccgctaccgaccttggtgcaacggcgataaaagcggcgtgt
gaatcagtaggcggcgacaatatcgacgaagttatcatgggttgtgtgttgcctgctggt
ctcggacagtctcctgctcgtcaagcgtcattagccgcaggtctgccgcttggcgctggt
gtaaccactatcaataaagtatgcggttcaggcctcaaagcagtcatgcttgctcacgac
cttattaaagcgggcagtgctacaagtattgtcgctggcggcatggaaagtatgagtaat
gcaccgtatttattgcccaaagcccgaagcggttatcgtatgggccacggccaagtactc
gatcatatgatgcttgatggtctggaaaacgcttacgacggaaaggcaatgggctgcttt
gctcaatctacggcggatgaacaaaatattagccgtggagatatggatgaattcgcctta
agttcgttgtctaaagctcacgaagccattaatagtggtggctttagtgatgaaatagtt
gaggttactattaagactcgaaaaggcgacgtggtggtagacaccgatgaaggcccgggt
aatgccagacctgagaaaatacccacattgcgcccggcattcaccaaagacggaacggtc
accgcagccaattcaagttctatctccgatggtgcggcggcattggttgtgatgagtgag
tcgaaagccgctgagttagggttaaccccactagcgaaagtggtcgctcatgccacccat
tctattgaacctgaaaatttcacacttgcgccagtgggggcgatgaagaaggttttagaa
aaagcgaattgggttaaagaagaagtggatttgttcgaaatcaacgaagcgttcgcaatg
gtcactatgatggctattcgtcagttacaattagatgaaaagaaagtgaatgttaaagga
ggcgcctgtgctcttggtcatcctattggcgcatctggggcaagaatcttagtgacgtta
cttcatgcattaaagcaaaaaaatgcacgaaaagggattgcctctttatgcattggtggt
ggcgaaggtgtcgccttggctgtggaaatgctttaa

DBGET integrated database retrieval system