KEGG   Alteromonas australica DE170: EP12_09220Help
Entry
EP12_09220        CDS       T03858                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
aaus  Alteromonas australica DE170
Pathway
aaus00020  Citrate cycle (TCA cycle)
aaus00480  Glutathione metabolism
aaus01100  Metabolic pathways
aaus01110  Biosynthesis of secondary metabolites
aaus01120  Microbial metabolism in diverse environments
aaus01130  Biosynthesis of antibiotics
aaus01200  Carbon metabolism
aaus01210  2-Oxocarboxylic acid metabolism
aaus01230  Biosynthesis of amino acids
Module
aaus_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aaus_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:aaus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EP12_09220
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EP12_09220
Enzymes [BR:aaus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     EP12_09220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AJP43813
UniProt: A0A075NZ53
Position
1998403..2000622
Genome map
AA seq 739 aa AA seqDB search
MTKSTIIYTKTDEAPMLATYSLLPIIKKFAAAADIDVELSDISLAARVLANFPEYLSDEQ
KVPDALAELGEMTQDPNVNIIKLPNISASIPQLRATIKELNDKGFNVPAFPDSPKTDEEK
DIRERYGKVLGSAVNPVLREGNSDRRAPTAVKNYARKHPHSMGEWSQASRSHVAHMRGGD
FYSAEKSVTVEKDGYVSIEFTGKDGSKKTLKPRVDLLAGEVIDGMFMSKKALCAFFEEQI
EDAKNTGVLFSLHVKATMMKVSHPIVFGHCVKVFYKDLFNKWGDLFEELGVNPNNGLGSV
YDKIATLPESQRSEIEKDINACYADRPPMAMVNSDKGISNLHVPSDVIVDASMPAMIRNS
GQMWGPDGKAHDTKAVIPESTYATIYQEVINFCKTHGAFDPTTMGTVPNVGLMAQKAEEY
GSHDKTFELEADGTVSIVDQDGNVLISHEVEEGDIWRMCQVKDAPIQDWVKLAVTRARQS
GMPAVFWLDDERAHDAQLITKVETYLKDHDTSGLNIQIMSPVRAIRYSMERAIRGLDTIS
VTGNVLRDYLTDLFPILELGTSAKMLSIVPLMAGGGLYETGAGGSAPKHVQQFVEEGHLR
WDSLGEFLALAVSLEDVAIKHKNAKAKIIASALDKATEKLLNNGKSPLRKAGQLDNRGSH
VYLGLYWAEEVANQTEDADLAAQFKPVYEELSAKIDDIIAEIDATQGKAQEIGGYYYPDE
DKLFATMSPSATLKSILDA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagtctacgatcatctatacgaagacggatgaagcgccaatgttggcaacttat
tcgttgcttcccattattaagaagtttgcagcagctgcagacatcgatgttgagttgagc
gacatctctttagctgctcgcgttctggcaaatttcccagagtatctctctgacgaacaa
aaagtaccagacgcattagccgaacttggcgagatgacacaagaccctaatgtaaacatc
atcaaactccctaatatcagcgcctcaattcctcagcttcgtgcaacgattaaagaactt
aatgataaaggctttaacgttccagcatttcctgattcgccaaaaactgacgaagagaaa
gacattcgtgagcgttatggaaaggttcttggtagtgcagtgaaccctgttctacgtgaa
ggtaactctgaccgccgtgcgcctactgcggttaaaaactatgcgcgcaagcacccgcat
tcaatgggagagtggtcacaagcatctcgctctcacgttgcacacatgcgtggtggcgac
ttctactcagctgaaaaatcagtcacggtagaaaaagacggttatgtgagcattgaattc
acgggtaaagatggcagcaaaaaaacgcttaaacctcgtgttgacttgctagcgggtgaa
gttattgatggtatgttcatgagcaagaaagcactttgtgccttctttgaagaacaaatt
gaagatgccaagaacacaggtgtgcttttctcacttcacgttaaagccacaatgatgaag
gtttctcaccccattgtatttggtcactgcgtaaaagtattttataaagacctatttaac
aaatggggcgacctgtttgaagagcttggcgttaaccctaacaatggtttaggcagcgta
tacgataaaatagctacgcttcctgaaagccagcgttcagaaattgaaaaagacatcaac
gcttgttacgccgatcgcccacccatggccatggtaaattctgataagggtatatctaat
ctgcacgtaccgagtgacgttattgttgatgcttctatgcctgcaatgatccgtaactct
ggtcaaatgtgggggccagatggtaaggctcacgatactaaagcggttattccagaaagt
acttacgccactatttatcaagaagtgattaacttctgtaaaacccacggtgcatttgac
ccaacaaccatgggtacggtacctaacgtaggtttgatggcgcaaaaagcggaagagtac
ggctcacacgataaaacatttgagctagaagccgatggtactgtctctattgtggatcaa
gacggtaacgttcttatttctcatgaagttgaagaaggtgatatctggcgtatgtgtcag
gtgaaagatgcacctattcaagattgggttaagttggccgtaacccgtgcccgtcaatca
ggcatgccagcggtattctggcttgacgatgagcgtgctcacgatgcacagcttattacg
aaggttgaaacctaccttaaagatcacgacaccagtggtttgaatattcaaattatgtcg
ccagttcgtgctatacgctacagcatggagcgcgctattcgtggcctagacactatttct
gtcaccggtaacgttctacgtgattacctgaccgatttgttcccaattttagaactgggt
accagtgctaaaatgctatccattgtgccactaatggccggtggtggtctgtacgaaaca
ggggcgggcggttctgcacctaagcacgtacagcagtttgtggaagagggtcatttacgt
tgggactcactcggtgagttcttggcgttagcagtgtcacttgaagatgtggcgattaaa
cacaaaaatgcgaaagcgaaaattattgcgagtgcattagacaaagcgactgaaaaactg
cttaacaacggtaaatctccattgcgtaaagcaggccagttagataaccgtggtagccat
gtttacctaggcttgtactgggcagaagaagtggcgaatcaaactgaagatgcagattta
gcggcgcagtttaagccggtttacgaagaattatcggctaaaattgatgacatcattgct
gaaatcgatgcaacgcaaggtaaagcacaagaaatcggtggttactattaccctgatgaa
gacaagttgtttgcaactatgtcacctagtgctaccctgaaatcaattcttgatgcgtaa

DBGET integrated database retrieval system