KEGG   Acidovorax citrulli: Aave_0142Help
Entry
Aave_0142         CDS       T00451                                 

Definition
(GenBank) L-threonine ammonia-lyase
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
aav  Acidovorax citrulli
Pathway
aav00260  Glycine, serine and threonine metabolism
aav00290  Valine, leucine and isoleucine biosynthesis
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
aav01130  Biosynthesis of antibiotics
aav01200  Carbon metabolism
aav01230  Biosynthesis of amino acids
Module
aav_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aave_0142
   00290 Valine, leucine and isoleucine biosynthesis
    Aave_0142
Enzymes [BR:aav01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     Aave_0142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP ACT ACT_4 ACT_6
Motif
Other DBs
NCBI-ProteinID: ABM30754
UniProt: A1TIG6
Position
complement(152775..153983)
Genome map
AA seq 402 aa AA seqDB search
MAHMLTLPDIQAAAARLQGQVLDTPCVESRTLSQIVGAQVFLKFENLQFTASFKERGACN
KLSQLSPEEQRRGVIAMSAGNHAQGVAYHAQRLGLAAVIVMPRFTPGVKVERTRGFGAEV
VLHGDTLEEARAHAYALAEERGLTFVHPYDDEAVAAGQGTVGLEMLQAVPDLDCLAIAVG
GGGLIAGIATAAKALKPGIEIIGVQTSRFPAMVNAVKGTQHPQGTSTIAEGIAVGTPGQV
TREVIARLVDDLLLVDEGDIEQAVLMLLEIEKTLVEGAGAAGLAALLRHPERFRGKRVGL
VLCGGNIDPLLLAAIIERGMVRSGRLARVKVSARDIPGVLARITATVAEAGANIEEVHHQ
RAFTMLAAQNVEIELVLQTRGREHVQQVLACLRQASMEAELL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacatgctgaccctccccgacatccaggccgccgccgcccgcctccagggccag
gtgctcgacaccccctgcgtcgaatcgcgcacgctctcgcagatcgtgggcgcgcaggtg
ttcctcaagttcgagaacctgcagttcaccgcctccttcaaggagcgtggtgcctgcaac
aagctgagccagctttcgcccgaggagcagcggcgcggcgtgatcgccatgagcgccggc
aaccatgcccagggcgtggcctaccacgcgcagcgcctgggcctggccgccgtgatcgtg
atgccgcgcttcacgcccggcgtgaaggtggagcgcacgcgcggcttcggcgccgaggtc
gtgctgcacggcgacacgctggaggaggctcgcgcgcatgcctatgccctggccgaggag
cgggggctcactttcgtgcatccctacgacgacgaggccgtcgccgcaggccagggcacc
gtcggcctggagatgctgcaggcggtgccggacctggactgcctggccatcgccgtgggc
ggaggcggcctgatcgcgggcatcgccaccgcggccaaggccctgaaaccgggcatcgag
atcatcggcgtgcagacctcgcgcttcccggccatggtcaacgcggtcaagggcacgcag
cacccgcagggcacctccaccatcgccgagggcatcgccgtgggcacgcccggccaggtg
acccgcgaggtgatcgcgcggctcgtggacgacctgctgctcgtggacgagggcgacatc
gagcaggccgtgctcatgctgctggaaatcgagaagaccctcgtcgagggcgccggcgcc
gccggcctggcagcgctgcttcggcacccggagcgcttccgcggcaagcgggtgggcctg
gtgctgtgcggcggcaacatcgaccccttgctgctggcggccatcatcgagcgcggcatg
gtgcgctccgggcgcctggcgcgcgtcaaggtgagtgcgcgcgacatcccgggcgtgctc
gcgcgcatcacggccacggtggccgaagcgggcgccaacatcgaggaagtccaccaccag
cgcgccttcaccatgctggccgcccagaacgtggagatcgaactcgtgctgcagacgcgg
ggccgcgagcatgtgcagcaggtactggcctgcctccgccaagcgtccatggaagccgaa
ctcctgtga

DBGET integrated database retrieval system