KEGG   Acidovorax citrulli: Aave_0437Help
Entry
Aave_0437         CDS       T00451                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
aav  Acidovorax citrulli
Brite
KEGG Orthology (KO) [BR:aav00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Aave_0437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF11
Motif
Other DBs
NCBI-ProteinID: ABM31044
UniProt: A1TJA6
Position
complement(475425..475835)
Genome map
AA seq 136 aa AA seqDB search
MPKYQFRAEVQPEYLPDQSAPEDGVYSFAYTVTVTNTGDVPAQLIARHWTISDARGHTEE
VKGLGVVGQQPLLRPGEAFQYTSGCRLRTPSGSMHGSYFCVAEDGERFDCAIPLFVLEAL
SGGPAGSTPLSGRVLH
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagtaccagttccgggccgaagtccagcccgaataccttcccgaccagtccgcg
cccgaagacggcgtctacagcttcgcctacacggtcaccgtgaccaacaccggcgacgtg
ccagcgcagctcatcgcgcggcactggacgatcagcgacgcccgcggccacaccgaggag
gtcaagggcctgggcgtggtcggccagcagccgctgctgcgcccgggcgaggcgttccag
tacaccagcggatgccggctgcgcacgcccagcggcagcatgcacggcagctacttctgc
gtggcggaggacggtgagcgcttcgattgcgccatccccctgttcgtgctggaagccctc
tccggcggccccgccggaagcacgcccctgtccggccgggtgctgcattga

DBGET integrated database retrieval system