KEGG   Acidovorax citrulli: Aave_0502
Entry
Aave_0502         CDS       T00451                                 
Name
(GenBank) conserved hypothetical protein
Organism
aav  Acidovorax citrulli
SSDB
Motif
Pfam: TraC_F_IV FtsK_SpoIIIE AAA_22 P-loop_TraG AAA_10 TrwB_AAD_bind T2SSE AAA_7 AAA_16 ATPase_2 DUF87 AIG1 DUF4913 Pox_A32
Other DBs
NCBI-ProteinID: ABM31108
UniProt: A1TJH0
Position
complement(545993..548929)
AA seq 978 aa
MPRHPHWRWSERAAGALHRLRSGVAAMGSAAPDHPGAEPPDAWDTHIARLAENGIPPPGA
HVRPSGAPPATEDDERALYGVSPSFVDMLPWAEYLPESRCMLLDDGVSVAAFFELVPIGT
EGREMAWLWQARDALENALQDAFDELDDHPWVVQLYAQDEASWDRYLRGLDAYVQPRARD
TAFTTFYQRFFAHHLRAIAKPGGLFEDTAVTRLPWRGQARRVRMVVYRRLGDAASQRRGL
SPEQALATICDRLQGGLANAGVRAERLGAADIHAWLLRWFNPQPRLLGDTALDRERFYDL
TRYPDEAEEGDIELASGTDFTQRLFFGPPRSDVDNGLWWFDGMPHRAVVMDRLRNAPGTG
HLTGETRKGDAINALFDQVPEDTVMCLTLVATPQDVLESHLNHLARKAVGETLASEQTRR
DVQEARGLIGSAHKLYRGALAFYLRGQDLAQLDERGVQLANVMLGAGLQPVREDDEVAPL
NTYLRWLPCVFDAAKDTRQWYTQLMFVQHAANLAPVWGRSRGTGHPGITLFNRGGDTITF
DPLNRLDRQMNAHLFLFGPTGSGKSATLNNLLNQVTAMYRPRLFIVEAGNSFGLFGDFAA
RLGLTVNRVRLAPGAGVSLAPFADARRLVDTPSQVRTLDADALDEGPDAGGTASDGDEQR
DVLGELEITARLMITGGEDKEEARMTRADRSLIRQCILDAARRCTAAGRTVLTRDVRDAL
RERAGDANLPDMRRARLLEMADAMDMFCQGADGEMFDRAGTPWPEADITIVDLATYAREG
YNAQLSVAYISLINTVNNIAERDQFLGRPIINVTDEGHIITKNPLLAPYVVKITKMWRKL
GAWFWLGTQNLDDLPKAAEPMLNMIEWWICLSMPPDEVEKIARFRELNAAQKALMLSARK
EAGKFTEGVILSKSMELLFRAVPPSLYLAMAMTEPEEKAERFALMQQHGINELDAAILVA
ERIDRARGIEPLPHHALG
NT seq 2937 nt   +upstreamnt  +downstreamnt
atgccgcggcatccgcactggcgctggtccgagcgcgcggcaggtgcgctgcaccggctg
cgcagcggtgtcgccgcgatgggctccgccgctccggaccatccgggcgcggaaccgccg
gatgcgtgggacacgcacatcgcccggctcgccgagaacggcattccaccgccgggcgcc
cacgtccgcccgtccggcgcgccgcccgccaccgaagacgacgagcgcgccctctacggc
gtgtcgccctcgtttgtggacatgctgccctgggccgaatacctgccggagtcgcggtgc
atgctgctggacgacggcgtgtccgtcgcggcgttcttcgagctcgtgcccatcggcacc
gaaggccgcgagatggcgtggctgtggcaggcccgcgatgcgctggagaacgcgctgcag
gacgctttcgacgagttggacgaccacccctgggtggtgcagctttatgcccaggacgag
gccagttgggaccgctacctgcgcggcctggacgcctacgtgcagccgcgcgcgcgggac
accgccttcaccactttctaccaacgcttcttcgcccaccacctgcgcgccatcgccaag
cccggcggcctgttcgaggacaccgccgtgacgcgcctgccctggcgcggccaggcccgc
cgcgtgcggatggtggtctaccggcgcctcggcgatgccgccagccagcgccgcggcctg
tcgcccgaacaggcgctcgccactatctgcgaccgcctgcagggcggcctggccaacgcg
ggcgtgagggcggaacgcctgggcgccgccgatattcatgcctggctcctgcgctggttc
aatccccagccgcggctgctcggcgataccgcgctggaccgggaacgcttctacgacctg
acgcgctatcccgacgaagcggaggaaggcgacatcgaactcgcgagcggcaccgacttc
acgcagcgcctgttcttcggcccaccgcgctccgacgtggacaacggcctctggtggttc
gacggcatgccccaccgtgcggtggtgatggaccgcctgcgcaacgcgccgggcacgggt
cacctcacgggcgagacgcgcaagggcgacgcgatcaacgcgcttttcgatcaggtaccc
gaggacaccgtgatgtgcctcaccctggtcgccacgccgcaggacgtgctcgaatcccac
ttgaaccacctcgcgcgcaaggccgtgggtgagacgctggcctccgagcagacgcgccgc
gacgtgcaggaggcgcgtggcctcatcggcagcgcgcacaagctctaccggggcgctctc
gccttctacctgcgcgggcaggatctcgcgcagctggacgaacgcggcgtgcagcttgcc
aacgtgatgctgggcgccggccttcagccggtgcgcgaggacgacgaggtcgcccccctc
aacacctacctgcgatggctgccctgcgtgttcgacgcggcgaaggacacacggcagtgg
tacacgcaactgatgttcgtgcagcacgcggccaacctcgcgcccgtctgggggcgcagc
cgcggcacggggcaccccggcatcacgctgttcaaccgcggcggcgacaccatcaccttc
gatccgctcaaccggctggaccggcagatgaacgcccatctgttcctgttcgggcccacg
gggtcgggcaagagcgccaccctcaacaacctgctcaaccaggtgacggcgatgtaccgc
cctcgcctcttcatcgtcgaggcgggcaactcgttcgggctgttcggcgacttcgccgcc
cgcctgggcctcaccgtgaaccgcgtgcggctcgccccgggcgcgggtgtgagcctcgca
cccttcgccgatgcgcggcgcctggtggacacgcccagccaggtccgcacgctcgacgcc
gatgccctcgatgaagggccagatgccggcggcaccgcttccgacggggacgagcagcgc
gacgtgctcggcgaactggagatcaccgcccgcctcatgattaccggcggagaggacaag
gaagaggcgcgcatgacgcgcgccgaccgcagtctgatccgccagtgcatcctcgatgcc
gcccgccgctgcacggccgcgggccgcaccgtgctgacgcgggacgtgcgcgacgcgctg
cgcgaacgggcgggcgacgccaacctgcccgatatgcgccgcgcccggctgctggaaatg
gcggatgccatggacatgttctgccagggcgcggacggagagatgttcgaccgcgccggc
acgccctggcccgaggccgacatcaccatcgtggacctcgccacctacgcgcgcgagggc
tataacgcccagctctcggtggcgtacatctcgctcataaataccgtcaacaacatcgcg
gagcgcgaccagttcctcggccggcccatcatcaacgtcaccgacgagggccacatcatc
accaagaatccgctgctcgcgccctacgtcgtgaagatcacgaagatgtggcgcaagctc
ggcgcctggttttggctcgggacacaaaacctggacgacctgccgaaggcggccgagccg
atgctgaacatgatcgagtggtggatctgcctgtccatgccgcccgacgaggtggagaag
atcgcccgcttccgcgagctcaacgccgcgcagaaagcgctgatgctctcggcccgcaag
gaggcgggcaagttcactgagggcgtgatcctctccaagtccatggagctgcttttccgg
gcggtgccgcccagcctgtacctggccatggccatgaccgaacccgaagagaaagccgaa
cgctttgctttgatgcagcagcacggcatcaacgagctcgacgccgccatcctggtcgcc
gagcgcatcgatcgcgcacgcggcatcgagccgctgccgcaccacgccctgggctga

DBGET integrated database retrieval system