KEGG   Acidovorax citrulli: Aave_0510Help
Entry
Aave_0510         CDS       T00451                                 

Definition
(GenBank) conserved hypothetical protein
Organism
aav  Acidovorax citrulli
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Plasmid_RAQPRD
Motif
Other DBs
NCBI-ProteinID: ABM31116
UniProt: A1TJH8
Position
complement(553638..554015)
Genome map
AA seq 125 aa AA seqDB search
MTSRATASHAASPRLPLSGVLAVALLCGATSASADTALERERLAGAQRLLDQADRLAATA
APAAASEPSRYHFDYARLHDDVRRMQTGFASYLIPVRAQPRDPSALAGQYTRENAPGPAP
AEQRR
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgcgtgccacggccagccacgccgcatcccctcgcctccccctgtccggcgtg
ctggccgtggcactcctttgtggcgcgacgtccgccagcgccgacaccgccctcgaacgc
gagcggctggcgggggcgcagcgcctgctcgatcaggccgaccggctcgccgccacggcg
gctcccgcagcggcttccgagccctcccggtaccacttcgactacgcgcgcctgcacgac
gacgtgcgccgcatgcagacgggcttcgccagctacctgatcccggtgcgcgcgcagccg
cgcgatccgtccgcgctggcgggccagtacacgcgcgagaacgcgccggggccggcgcct
gcggagcagcgccgatga

DBGET integrated database retrieval system