KEGG   Acidovorax citrulli: Aave_0529
Entry
Aave_0529         CDS       T00451                                 

Definition
(GenBank) Lytic transglycosylase, catalytic
Organism
aav  Acidovorax citrulli
SSDB
Motif
Pfam: SLT Glucosaminidase
Other DBs
NCBI-ProteinID: ABM31134
UniProt: A1TJJ6
Position
complement(573364..573972)
AA seq 202 aa
MAATVIPQRCTTVLRWAIALGTAACSAVPALAQELPPPAYQIAAAQSGVPSSVLYAVALQ
ESGTRLRGRLVPWPWTLNVAGTPQRHATRADACLALRSALRDTPAERIDVGLGQVNAGYH
AHRVQRPCALLDPYRNLGIAAEILHEQYRPGEDWLAAVGRYHRPAGGPPAARYRGAVQRH
LVRLLGNPQAMASLHPRRETTP
NT seq 609 nt   +upstreamnt  +downstreamnt
atggcagcgacagtgattcctcagcgctgcaccacggtccttcgatgggcgatcgcactg
ggcacggccgcatgcagcgccgtgcccgccctcgcccaggagcttcccccgcccgcctac
cagatcgccgcggcgcaatcgggcgtgccctcgtccgtgctgtacgcggtcgcgctgcag
gagagcggaacccggctgcgcggccggctggttccctggccgtggacgctcaacgtcgcc
ggcacgccgcagcggcacgccacgcgcgctgacgcctgccttgcgctgcgcagcgcactg
cgggacacccccgccgaacgcatcgacgtcgggctcggccaggtcaatgcgggctaccac
gcgcaccgcgtgcagcgaccctgcgcgctgctggacccctaccgcaacctcggtatcgcc
gcagaaatcctgcatgagcagtaccggcccggcgaagactggctggccgcggtgggccgc
taccaccgccccgcaggcggcccgcccgcagcgcgctaccgcggcgccgtgcagcgccac
ctcgtgcgcttgctgggcaacccgcaggcgatggcctcactgcatccgcgtcgagagacc
accccatga

DBGET integrated database retrieval system