KEGG   Acidovorax citrulli: Aave_0530
Entry
Aave_0530         CDS       T00451                                 

Definition
(GenBank) conserved hypothetical protein
Organism
aav  Acidovorax citrulli
SSDB
Motif
Pfam: Mobilization_B DUF1681
Other DBs
NCBI-ProteinID: ABM31135
UniProt: A1TJJ7
Position
complement(573957..574715)
AA seq 252 aa
MRAESPSAIAVFIAVSLCALGLGAPNVAQAQAQAARVGETRTTASAARPLADAHDDEARA
REWGLRAEDWSRYRTLMQGPLGIYSPNLDPLTALGIEARSDEERRRYAELQVQAEARRVQ
KTLDYQRAYDAAWQRLYPDQQRVALQAGPAAGSSGTAEPGRLALFVKEDCAACDQRVQQL
QSAGTPVDVYLIGSRGDDERIRRWARRAGVDPAKVRARTITLNHDGGRWLSLGASGDLPA
VMREVGGQWQRQ
NT seq 759 nt   +upstreamnt  +downstreamnt
atgcgagcggaaagcccttcagccatcgcggtattcattgcggtaagcctgtgcgccctt
ggcctgggtgcgcccaacgtggcgcaggcgcaggcgcaagcagcgcgcgtcggcgagacc
cgcaccacggcaagcgcagcacggccgttggccgatgcgcacgacgacgaggcccgggcc
cgcgaatggggcctgcgcgcggaggactggtcgcgctaccggacgttgatgcaggggcct
ctcggcatctactcccccaacctcgatccgctgacggcactcggcatcgaggcacgcagt
gacgaggagcggcgacgatacgcggagctccaggtgcaggccgaggcccgccgcgtgcaa
aaaaccctggactaccagcgtgcatacgacgcggcatggcagcggctgtaccccgaccag
cagcgcgtggcactgcaggccggcccggcggccggcagcagcggtaccgcggaaccggga
cgcttggccctgttcgtgaaggaggattgcgccgcgtgcgaccagcgcgtgcagcagctc
cagtccgccggcacaccggtggacgtgtacctgatcggaagccgcggcgacgacgagcgc
atccgccggtgggcgcggcgagcgggcgtcgatcccgccaaggtgcgggcgcggacgatc
acgctcaaccacgatggcggccgctggctgtcgctcggcgcgtccggcgatcttccggcg
gtcatgcgcgaggtgggtggccaatggcagcgacagtga

DBGET integrated database retrieval system