KEGG   Acidovorax citrulli: Aave_0734Help
Entry
Aave_0734         CDS       T00451                                 

Definition
(GenBank) Conjugal transfer protein TrbG/VirB9/CagX
  KO
K20532  type IV secretion system protein TrbG
Organism
aav  Acidovorax citrulli
Pathway
aav02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:aav00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Aave_0734
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aav02044]
    Aave_0734
Secretion system [BR:aav02044]
 Type IV secretion system
  Trb secretion system protein
   Aave_0734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagX
Motif
Other DBs
NCBI-ProteinID: ABM31334
UniProt: A1TK46
Position
787689..788693
Genome map
AA seq 334 aa AA seqDB search
MNARFRKTALPVILLASTVLFAGCAMQGKPPPVISLDEPVQAQPLPEPPKPIEVVAVPEP
LALPAQLKPLPDVGAAPTTPEPADEKVRVSRANAEARIAPTREGYVNAIQVWPFTDGALY
QVYASVGRVTVIALQPGEELVTVAAGDTVRWIVGDTSSGSGADLRVNVLVKPIRSGLKTN
LVITTSRRTYLLELTSTDKAWMASVSWDYPKDRMLALQRQAQAANAAAPVDAGLSLENIR
FRYAISGSNPPWKPLRAFDDGEKVYIQFPAGIAQGELPPLFVIGAQGDGQLVNYRFRSPY
YIVDRLFGAAELRLGADKGDVVRIERTDGIAGRN
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacgtttccgtaaaaccgcattgccggtgatcctgctggcatcgactgttctg
tttgcaggctgcgccatgcaaggcaaaccgccgccggtgatctcgctcgatgagccggtt
caggcgcagccattgcccgagccgcccaaacccatcgaagtggtggccgtgcccgaaccg
ttggcattgcccgcacagttgaagccgctgccggacgttggtgcggccccgaccacgccg
gagcctgccgacgagaaggtgcgcgtctcccgcgccaatgccgaagcacggatcgcgccg
acccgagagggctacgtcaatgcgatccaggtctggcccttcaccgatggcgcgctctat
caggtctatgcgtccgtaggccgcgtaaccgtgatcgcgctccaacccggtgaggaactg
gtgacggtggccgcaggcgataccgtgcgctggatcgtcggtgacacctccagcggcagc
ggtgccgatttgcgcgtcaatgtgctggtgaaacccatccgttccggcctcaaaaccaat
ctggtcatcaccaccagccgccgcacctatctgctggaactgacttcgaccgacaaggcg
tggatggcctcggtgtcctgggactatcccaaggatcggatgctggccttgcagcgccag
gcacaggctgccaacgcagccgcgccggttgatgcgggcctgtcgctggagaacatccgc
tttcgctacgcgatcagcggcagcaatccgccgtggaagccgctgcgggctttcgatgat
ggcgagaaggtctatatccagttcccggcaggcatcgcccagggcgagctgccgccgctg
ttcgtcatcggtgcgcagggcgatgggcaactggtgaactaccgtttccgctcgccttac
tacatcgtggatcgtctgttcggtgcggcagaactgcgcctgggggccgacaagggcgat
gtggtgcgcatcgagcgcacggatggcatcgccgggaggaactga

DBGET integrated database retrieval system