KEGG   Acidovorax citrulli: Aave_0910Help
Entry
Aave_0910         CDS       T00451                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
aav  Acidovorax citrulli
Pathway
aav00240  Pyrimidine metabolism
aav00250  Alanine, aspartate and glutamate metabolism
aav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Aave_0910
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Aave_0910
Enzymes [BR:aav01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Aave_0910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABM31508
UniProt: A1TKM0
Position
991465..992427
Genome map
AA seq 320 aa AA seqDB search
MLSKRNPQLNRNGELIHLLSIEGLPRSIVTHILDTAANFVSVNDREVKKVPLLRGKSVFN
LFFENSTRTRTTFEIAAKRLSADVLNLDIARSSASKGESLLDTIANLSAMAADLFVVRHS
ESGAPYLIAQHVAPHVHVINAGDGRHAHPTQGLLDMYTIRHYKKDFSNLTVAIVGDVLHS
RVARSDIHGLTTLGCPEVRVVGPRTLVPGDLSHMGVRVCHTLEEGIRDADVVIMLRLQNE
RMSGALLPSSQEYFKSFGLTPEKLRLAKPDAIVMHPGPINRGVEIDSAVVDGPQAVILPQ
VTFGIAVRMAVMSIVAGNEA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgctctccaagcgcaacccccagctcaatcgcaatggcgagttgatccacctgctgtcc
atcgaaggcctgccgcgcagcatcgtcacgcacatcctcgatacggcggcgaacttcgtg
tcggtgaacgaccgcgaggtgaagaaggtgccgctgctgcgcggcaagagcgtgttcaac
ctgttcttcgagaacagcacgcgcacccgcacgaccttcgagatcgcggccaagcgcctg
tcggccgacgtgctcaacctcgacatcgcgcgctcgtccgccagcaagggcgaatcgctg
ctggacaccatcgccaacctctcggccatggcggcagacctgttcgtggtgcggcacagc
gaatcgggcgcgccctacctgatcgcgcagcacgtggcgccgcacgtacacgtgatcaac
gcgggcgacggccggcatgcgcaccccacgcaggggctgctcgacatgtacaccatccgc
cactacaagaaggatttctccaacctcacggtggcgatcgtgggcgacgtgctgcattcg
cgcgtggcccgctcggacatccacggcctgaccaccctgggctgccccgaggtgcgcgtg
gtgggcccgcgcaccctggtgcccggagacctttcccacatgggcgtgcgcgtgtgccac
acgctggaagagggcatcagggacgccgacgtggtcatcatgctgcgcctgcagaacgag
cgaatgagcggcgcgctgctgccctccagccaggaatacttcaagagcttcggcctcacg
cccgagaagctgcgcctggccaagcccgacgccatcgtcatgcaccccgggccgatcaac
cgcggggtggaaatcgactccgccgtggtcgatggaccgcaggccgtgatcctgccccag
gtgactttcggcatcgccgtgcgcatggccgtgatgtccatcgtggcggggaatgaggct
taa

DBGET integrated database retrieval system