KEGG   Acidovorax citrulli: Aave_1214Help
Entry
Aave_1214         CDS       T00451                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aav  Acidovorax citrulli
Pathway
aav00260  Glycine, serine and threonine metabolism
aav00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
aav01130  Biosynthesis of antibiotics
aav01230  Biosynthesis of amino acids
Module
aav_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aave_1214
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Aave_1214
Enzymes [BR:aav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Aave_1214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ABM31805
UniProt: A1TLG7
Position
complement(1336459..1337316)
Genome map
AA seq 285 aa AA seqDB search
MSADMTTSASTAPLAAQGRIAATFADLQARGRKALIPYVTAGFPFADITPALMHGMVEAG
ADVIELGVPFSDPMADGPVIQKAGEKALSLGVGMAQVLGYVREFRQRNTKTPVVLMGYAN
PVERYDQRHGDNAFVRDAAEAGVDGVLIVDYPPEECEDFAARLRAHGMDLIFLLAPTSTE
QRMQQVARVASGYVYYVSLKGVTGSGALDTSAVEAMLPVIRRHVHIPVGVGFGIRDAATA
QAIGRVADAVVIGSRIIQLLEDQPHERVVPLAVDFLRGVRKALDT
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgacatgacgacttccgcgtccacggcaccgctggccgcccaggggcgcatc
gcggcgacgttcgccgacctgcaggcccgcggccgcaaggccctcattccctacgtgacc
gccggcttcccgttcgcggacatcacgcccgcgctgatgcacggcatggtggaggccggc
gccgatgtgatcgaactcggcgtgccgttctccgatcccatggccgacggcccggtgatc
cagaaggccggggagaaggccctctccctgggcgtgggcatggcccaggtgctcggctat
gtgcgcgagttccgccagcgcaacacgaagaccccggtggtgctcatgggctacgccaac
ccggtggaacgctacgaccagcgccacggagacaacgccttcgtgcgcgatgcggccgag
gccggcgtggacggggtactgatcgtggattaccctcccgaagagtgcgaggacttcgca
gcccggctgcgcgcgcatggcatggacctgatcttcctgctggcgcccaccagcacggag
cagcgcatgcagcaggtggcgcgcgtcgcgagcggctacgtgtactacgtttcgctcaag
ggcgtgaccggctcgggcgccctcgatacttcggccgtggaagccatgctgccggtgatc
cgccgccatgtgcacatccccgtcggcgtgggtttcggcatccgcgatgcggccaccgcg
caggccatcggccgtgtcgcggatgccgtggtgatcggcagccgcatcatccaactgctg
gaagaccagccccacgagcgggtcgtgcccctggccgtggacttcctgcggggggtgcgc
aaggcgctcgacacgtag

DBGET integrated database retrieval system