KEGG   Acidovorax citrulli: Aave_1468
Entry
Aave_1468         CDS       T00451                                 

Definition
(GenBank) FHA domain containing protein
  KO
K07169  FHA domain-containing protein
Organism
aav  Acidovorax citrulli
Brite
KEGG Orthology (KO) [BR:aav00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    Aave_1468
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-ProteinID: ABM32059
UniProt: A1TM71
Position
1621473..1623806
AA seq 777 aa
MDKVELRVVRHADEAVDRLWTAVFGVAGGTIGRGGQNKLVLSDSDAGVARVHAMVRIESE
AAFIANLCERRSIFVAGAEVRSGEEVRLAVGDEVRIGPYVLHSVVPGSPFVPVAAVPAPV
PAPAPEPVSAPAPVANPSSPASAAGVPVPVSVPVAIPVANVPQGEGLTVVPSPPVAMPAA
GTGEGLAAAAASAEEDDNPFAMLGRVEGPAIAASAPSRAPAPAALPTASTAPIPAFGPVP
ADAPVPPSRSASMPAPDGVHGFAASPASAIPVPSDQGRQDNAWSPAVPQDRPAAAPAPRA
LVIPEDFDLFAVDPRKGEEKKDAWGSGLQAKSLSEIANMRHDELLQSLPASGAKFAHDMD
NPAHAGLPKALDPRDELDPLRLFTGGSDAASALVPERSAMVLGSGSDLSQSFSLPRGVQA
PVGPGLPGAAEVPGSSPPVVQGAGTNPGMASAAPPAPPLEGLQRVEGLDLGAFGSGSASA
DPLGWPPVESGPAPAAVDVLPQATLSGLAAGDAKAVPIEEVALAHVPAAAGTPAPVPAPA
PAPAPAPTASHGPAGEEGTPKSPLAPVLPELEAASPAELQSLIAAFLEGAGVLQKKVEPQ
KLSPEFMRSFGEAFRVAVQGTIDLLAARSEIKREFRAGVTVISSGANNPLKFLPTPEGVV
MQMIGQNFPGFMKPIPAMQEAYDDLRVHQVALMAGLRAAYAEALERFDPAALEQRTDVTG
GVFGKLSATSRKAALWDEYKRNFAEIRRGAEDDLAAFSGQAFLEAYENAEAAAKART
NT seq 2334 nt   +upstreamnt  +downstreamnt
atggacaaagtcgaactcagggtcgtccgccatgcggacgaagcggtggaccgcttatgg
acggcggtattcggcgtggcgggcggaacgatcggccgcggagggcagaacaagctcgtg
ctgtccgacagcgatgcgggtgtcgcccgcgtgcatgcgatggtgcgcatcgaatccgag
gccgccttcatcgccaatctctgcgagcgccggtcgattttcgtggcgggtgccgaagtg
cgctcgggcgaagaggtgcgcctggcagtgggggacgaggtccgcatcgggccctacgtc
ctgcattccgtcgtgccgggctcgcccttcgttcccgtggcggctgttcctgctccagtt
ccggctcccgcccccgaacccgtatctgcgcccgctccggtagcgaatccgtcgtccccg
gcctctgccgccggcgtgccggttcccgtttccgttcccgtagccattccggtggcgaac
gtgccgcagggcgaggggctgactgtcgtgccgtcgccgcctgtggcgatgcctgcggcc
ggaacgggagaaggcctggcggcggccgcggcctctgcggaggaagacgacaaccccttc
gcgatgcttggtcgcgtggaagggccggccatcgccgcctcggccccgtcccgggccccg
gcgccggccgccttgcccacggcctcgactgcgcccatacccgcgttcggccccgtgccc
gccgacgcacctgtgccgccatcccggtccgcgtccatgcctgccccggacggggtccat
ggtttcgccgcgtcgcccgcatcggcgattccggtgccttccgaccagggtcggcaggac
aatgcctggtccccggcggtgccgcaggacaggcccgccgcggcaccggccccccgggcc
ctcgtcattccggaggacttcgatcttttcgcggtggacccccgcaagggcgaggagaaa
aaggatgcctgggggagcggtttgcaggctaagagcctgagcgagatcgccaacatgcgg
cacgacgaactgctgcagtcgctgccggccagcggcgcgaaattcgcgcacgacatggac
aacccggcccatgccgggctgcccaaggcgctggacccgcgcgacgaactcgacccgctg
cggctcttcacgggcggctcggatgcggcctcggcactggtgcccgaacgttcggcgatg
gtgctcggttcggggtccgacctgtctcagtcgttcagccttccgaggggcgtgcaggcg
ccggtggggccggggctccccggcgcggcagaggtgccgggaagttccccgccggtcgtc
cagggcgccggcacgaacccgggcatggcgtccgccgcgccaccggcccctccgctggag
ggcctgcagcgtgtggaaggactcgaccttggtgccttcggctccggttccgcttcggcc
gatccactgggctggccgcccgtggagagcgggcccgcccccgctgctgtcgacgtgctg
ccgcaagccacgctttccgggctggctgccggcgatgcgaaggccgtgcccatcgaggag
gtggcgctggcgcatgttcctgccgcggccggcacgcctgctccagtcccggcgccggcc
cccgcgcccgctcctgcgcccaccgcctcccacggcccggctggggaagagggcaccccg
aagtcgcccctggctccggtgctgccggaactggaagccgcttcgccagcggagttgcag
tcgctgatcgccgccttcctggaaggcgcgggggtgctgcagaagaaggtcgagccgcag
aagctcagtcccgagttcatgcgatcgttcggggaagccttccgcgtggccgtgcagggc
accatcgacctgctggccgcccgctccgagatcaagcgcgaattccgcgcaggcgtgacg
gtgatttcctccggcgcgaacaatccgctgaagttcctgccgacgcccgagggcgtggtc
atgcagatgatcgggcagaatttcccggggttcatgaagccgatccccgccatgcaggag
gcctacgacgacctgcgggtccaccaggtggccctgatggccggcctgcgcgcggcctac
gccgaggcgctggagcgtttcgatcccgcggccctggagcagcgcaccgacgtgaccggt
ggggtgttcggcaagctgtcggccacgagccgcaaggcagcgctgtgggacgagtacaag
cgcaatttcgccgagatccggcgcggcgccgaggacgacctggcggccttctccggccag
gccttcctggaggcctatgaaaacgccgaggcggcggcgaaggccaggacgtga

DBGET integrated database retrieval system