KEGG   Acidovorax citrulli: Aave_1470
Entry
Aave_1470         CDS       T00451                                 

Definition
(GenBank) lipoprotein, putative
  KO
K11906  type VI secretion system protein VasD
Organism
aav  Acidovorax citrulli
Pathway
aav03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:aav00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Aave_1470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aav02044]
    Aave_1470
Secretion system [BR:aav02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Aave_1470
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ABM32061
UniProt: A1TM73
Position
1624635..1625198
AA seq 187 aa
MHREAMARKGFIRAGLAAAAAAWLLGGCGMISNLNRPQEAPTAVPPAVFEIVADPGVNPD
IHGTPKPILLRIYELRAAAAFDRASYLDLQDKDEAQLGADFVRREEILLQPGERRTIERK
GSADVRTFAVFAGYRDLERSTWRATAGAPNSVEMRRRWWGLGETERLKPVQYRITVGKDA
VKIQTAP
NT seq 564 nt   +upstreamnt  +downstreamnt
atgcatcgggaagcgatggcacggaagggattcatcagggcggggctcgcggccgcggcg
gcggcatggctgctgggcggctgcggcatgatcagcaacctgaaccgcccgcaggaggcc
cccacggccgtgccgccggccgtgttcgaaatcgtcgcggaccctggcgtcaaccccgat
atccacggcacgcccaagcccatcctgctgaggatttacgaactgcgcgcggcggcggct
ttcgaccgggcaagctacctggacctgcaggacaaggacgaagcccagctgggggccgat
ttcgtgcggcgcgaggagatcctgctgcagccgggcgagcggcgcaccatcgagcgcaag
ggcagtgcggatgtccgcaccttcgccgtgttcgcaggctaccgcgacctggagcgcagc
acctggcgcgcgaccgcgggcgctcccaactccgtggagatgcgccgccgctggtggggc
ctgggcgaaaccgagcggctcaagcccgtgcagtaccgcatcacagtgggcaaggatgcg
gtgaagatccagaccgctccttaa

DBGET integrated database retrieval system