KEGG   Acidovorax citrulli: Aave_1652Help
Entry
Aave_1652         CDS       T00451                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA lyase
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
aav  Acidovorax citrulli
Pathway
aav00072  Synthesis and degradation of ketone bodies
aav00280  Valine, leucine and isoleucine degradation
aav00281  Geraniol degradation
aav00650  Butanoate metabolism
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Aave_1652
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Aave_1652
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Aave_1652
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    Aave_1652
Enzymes [BR:aav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     Aave_1652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-ProteinID: ABM32239
UniProt: A1TMQ1
Position
1811321..1812301
Genome map
AA seq 326 aa AA seqDB search
MNAGGTVWHGAGRRIHMQEVGTRDGLQMEQAFVPTEDKIALVDALSAAGLAKIEVTAFVS
PAAIPALRDAEIVMREIARRPGVVYAALVPNVRGAERAIEARTDELNLVMSASETHNLAN
LRMTRAQSFAALAQVVATAQGAGVAVNVSLSCVFGCPMEGDVAGAEVFGWVQRFADLGVG
GITLCDTTGMAYPAQVAALVAAARARWPAMAFTLHFHNTRGMGLANVLAAIDAGADRFDA
SLGGLGGCPYAPGASGNVCSEEVVHALELMGYDTGVDLPALLAAARRLPALIGHDIPGQI
AKAGARLDLHPVPADFAAIRERALAR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccggcggcacggtgtggcacggcgccgggcgccgcatccacatgcaggaagtg
ggcacgcgcgacggcctgcagatggagcaggccttcgtgcccaccgaagacaagatcgcg
ctggtggacgcgctgtccgccgcgggcctggccaagatcgaggtgacggccttcgtgtcg
cccgcggcgatcccggcgctgcgcgacgcggagatcgtgatgcgcgagatcgcgcgccgc
cccggcgtcgtctatgccgcgctggtgccgaacgtgcgcggcgcggagcgcgcgatcgag
gcgcgcaccgacgagctgaacctggtgatgtccgccagcgagacgcacaacctcgccaac
ctgcgcatgacgcgcgcgcagtccttcgcggccctcgcgcaggtggtggccacggcgcag
ggcgcgggcgtggcggtgaacgtgtcgctctcgtgcgtgttcggctgcccgatggagggc
gacgtcgccggggcggaggtgttcggatgggtgcagcgcttcgccgacctgggcgtgggc
ggcatcacgctgtgcgacaccaccggcatggcgtaccccgcgcaggtggcggcgctggtg
gccgcggcgcgcgcccgctggccggcaatggccttcacgctgcacttccacaacacgcgc
ggcatgggcctggccaacgtgctggcggcgatcgacgcgggcgcggaccggttcgacgcc
tcgctgggcgggctgggcggctgcccgtacgcgccgggtgcctcgggcaacgtctgcagc
gaggaggtcgtccatgcgctggagctcatgggctacgacacgggcgtggacctgccggcg
ctgctcgcggccgcgcggcggctgcccgcgctcatcgggcacgacatcccgggccagatc
gccaaggcgggcgcgcgcctggacctgcacccggtgcctgcggacttcgcggccatccgc
gagcgggcgctcgcgcgctga

KEGG   Acidovorax citrulli: Aave_4349Help
Entry
Aave_4349         CDS       T00451                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA lyase
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
aav  Acidovorax citrulli
Pathway
aav00072  Synthesis and degradation of ketone bodies
aav00280  Valine, leucine and isoleucine degradation
aav00281  Geraniol degradation
aav00650  Butanoate metabolism
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Aave_4349
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Aave_4349
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Aave_4349
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    Aave_4349
Enzymes [BR:aav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     Aave_4349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-ProteinID: ABM34889
UniProt: A1TVA1
Position
complement(4830667..4831578)
Genome map
AA seq 303 aa AA seqDB search
MSSLPTRAKIVDVGPRDGLQNEKSPVPASVKIGLVHRLQAAGLTEIEVTSYVSPKWVPQM
ADNHEVMAGIERLPGVRYSVLTPNLKGYEAAVLDRPDEIVVFGSASEAFSQKNINCSIAE
SIERFAPVVEAARAAGIHVRGAMSCTVGCPYEGEVAPERVGYLAGLMKGIGVQHIGVADT
IGVGTPRKVQRAIEATLAHYAVDDVSGHFHDTYGQALANTLAALEMGIWQFDTSVAGLGG
CPYAKGATGNVATEDVVYMLHGMGIETGIDLDALVDAGAYISDFLGRKPNSRAATALLNR
RAG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcccttcccacccgcgccaagatcgtggacgtcggcccgcgcgacgggctgcag
aacgagaaatcccccgtgccggccagcgtcaagatcggtctcgtgcaccggctgcaggcg
gccgggctgaccgagatcgaggtcacgagctatgtctctcccaaatgggtgccgcagatg
gcggacaaccatgaggtgatggccggcatcgagcggctcccgggcgtccgctattcggtg
ctgacgcccaacctgaagggctacgaggcggccgtgctggaccggcccgacgagatcgtt
gtgttcggctccgccagcgaggcgttcagccagaagaacatcaactgcagcatcgccgag
agcatcgagcgcttcgccccggtggtcgaggccgcgcgcgccgcgggcatccacgtgcgc
ggcgccatgagctgcaccgtgggctgcccctacgagggcgaagtggcgccggagcgcgtg
ggttacctggccgggctcatgaagggcatcggcgtgcagcatatcggcgtggcggacacc
atcggcgtgggcaccccgcgcaaggtgcagcgtgccatcgaggcgacgctcgcgcactat
gccgtggacgacgtttccgggcacttccacgatacctacgggcaggcgctcgccaacacc
ctggccgcgctggagatgggcatctggcagttcgacacgtcggtggccggcctgggcggc
tgtccctatgcgaagggggccacgggcaacgtggccaccgaggacgtggtgtacatgctg
cacggcatgggcatcgagacgggcatcgacctggatgcgctggtcgatgccggggcctac
atcagtgacttcctcggccgcaagccgaattcgcgcgccgccaccgccctgctgaacagg
cgcgccggctga

DBGET integrated database retrieval system