KEGG   Acidovorax citrulli: Aave_2014Help
Entry
Aave_2014         CDS       T00451                                 

Definition
(GenBank) farnesyl-diphosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
aav  Acidovorax citrulli
Pathway
aav00900  Terpenoid backbone biosynthesis
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
aav01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aav00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Aave_2014
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:aav01006]
    Aave_2014
Enzymes [BR:aav01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     Aave_2014
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     Aave_2014
Prenyltransferases [BR:aav01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   Aave_2014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt DUF3482
Motif
Other DBs
NCBI-ProteinID: ABM32598
UniProt: A1TNR0
Position
2189442..2190362
Genome map
AA seq 306 aa AA seqDB search
MGTAALSPHAGDAGFDLSAWSAQALRRVEQALETWVPADAPGGLGDAMRYAVLGAGKRLR
PLLVLAAAEAVSGHAGAALRAACSVELIHAYSLVHDDMPCMDNDVLRRGKPTVHVQFGQA
QALLAGDALQALAFELLTPEDDVPEAMQARLCRLLARAAGADGMAGGQAIDLASVGVALS
EDELRRMHRLKTGALLQSSVLMGAACGAVAPAAWDALSRYGAALGLAFQVVDDVLDVVAD
SATLGKTAGKDAASDKPTYVSLLGLDRARAYAAALRDEAHAALQDSGLAGTRVLAALADM
VIDRSR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgctgcgctttccccgcacgccggcgacgccggcttcgacctttccgcctgg
agcgcgcaggcactgcggcgtgtcgagcaagccctggaaacctgggtgcccgccgatgca
ccgggcggcctgggcgatgccatgcgctacgcggtgctgggcgccggaaagcggctgcgt
ccgctgctggtgctcgccgcggccgaggcagtgtcgggccatgccggcgcggccctgcgc
gcggcctgctcggtggagctgatccacgcgtattcgctggtgcacgacgacatgccctgc
atggacaacgacgtgctgcgccgcggcaagcccacggtgcacgtgcagttcgggcaggcc
caggcgctgctcgcgggcgatgcgctgcaggccctggccttcgaactgctcacgcccgag
gacgacgtgcccgaggccatgcaggcccggctgtgccgcctgctggcgcgggccgcgggc
gccgacggcatggccggcgggcaggcgatcgacctggccagcgtgggcgtcgcgctgtcg
gaagacgagctgcgccgcatgcaccgcctcaagaccggggcgctgctgcagtccagcgtg
ctgatgggcgcggcctgcggagcggtggcgcccgctgcgtgggacgccctgtcgcgctac
ggcgcggccctcgggctggccttccaggtggtggacgacgtgctcgacgtggtggccgat
tccgccacgctgggcaagacggccggcaaggacgcggccagcgacaagcccacctacgtc
tcgctgctggggctggaccgcgcgcgcgcctatgcggccgcgctgcgcgacgaggcgcac
gccgccctgcaggacagcggcctggcgggcacgcgcgtgctggcggcgctggccgacatg
gtgatcgaccgatcccgctga

DBGET integrated database retrieval system