KEGG   Acidovorax citrulli: Aave_2433Help
Entry
Aave_2433         CDS       T00451                                 

Definition
(GenBank) pyridine nucleotide-disulfide oxidoreductase dimerization region
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
aav  Acidovorax citrulli
Pathway
aav00010  Glycolysis / Gluconeogenesis
aav00020  Citrate cycle (TCA cycle)
aav00260  Glycine, serine and threonine metabolism
aav00280  Valine, leucine and isoleucine degradation
aav00310  Lysine degradation
aav00380  Tryptophan metabolism
aav00620  Pyruvate metabolism
aav00630  Glyoxylate and dicarboxylate metabolism
aav00640  Propanoate metabolism
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
aav01120  Microbial metabolism in diverse environments
aav01130  Biosynthesis of antibiotics
aav01200  Carbon metabolism
Module
aav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aav_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aave_2433
   00020 Citrate cycle (TCA cycle)
    Aave_2433
   00620 Pyruvate metabolism
    Aave_2433
   00630 Glyoxylate and dicarboxylate metabolism
    Aave_2433
   00640 Propanoate metabolism
    Aave_2433
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aave_2433
   00280 Valine, leucine and isoleucine degradation
    Aave_2433
   00310 Lysine degradation
    Aave_2433
   00380 Tryptophan metabolism
    Aave_2433
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aav04147]
    Aave_2433
Enzymes [BR:aav01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Aave_2433
Exosome [BR:aav04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Aave_2433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox_3 GIDA Pyr_redox K_oxygenase 2-Hacid_dh_C Thi4 3HCDH_N FAD_binding_2 HI0933_like DAO ThiF XdhC_C NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABM33008
UniProt: A1TPX0
Position
complement(2654607..2656019)
Genome map
AA seq 470 aa AA seqDB search
MSDTLDVIILGAGSAGLAALREVRKRTERVLIVNDGPWGTTCARVGCMPSKMLIEAADAF
HRRHSFDTFGIRGGRSLGLDLPAVLDRVRALRDDFVAGTRKASDIGAQGIAGHARLMGPH
RVEVDGRVYDTRSIIIATGSRPIVPEEWLAFGDRILTTDTLFEQRDLGPRMAIIGLGPLG
AEIAQALARLGVEVAAFSSRKEIAGLSDPAVNDALLGLLKSEFVLNVGAEVTLREVPGGI
EVTNGSATVVVDQVLAAMGRRPNVEHLGLETLGVELDKDGMPPVDRRTVQVGDLPVFMAG
DANDFRPLLHEAADDGHIAGLNALAPEVRGFRRRMPLSIVFTEPNAATVGRRYKDLKRDE
SVTGTVDFARQGRARVAQRNQGRLSLYAQRDTGRLLGAEMCAPAGEHMAHLLALAMDREL
TVHDLLRMPFYHPVLEEGLRSALRDAASQLPKGSDSDLSACDAYGSSALD
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacacgctggacgtcatcattctcggagcaggatccgccggcctcgccgcgttg
cgcgaagtgcgcaagcgcacggagcgggtgctgatcgtgaacgacggaccgtggggcacc
acctgcgcccgcgtggggtgcatgccgtcgaagatgctcatcgaggccgccgacgcattc
caccgccgccacagtttcgatacgttcggcatccgcgggggacggtcgctggggctggac
ctcccggccgtgctggaccgggtccgcgcgctgcgcgacgacttcgtcgcgggtacgcgc
aaggcgtccgacatcggcgcccagggcattgccgggcacgcgcggctcatgggcccgcac
cgcgtagaggtggatggccgcgtgtacgacacccgcagcatcatcatcgcgacaggttcc
cggcccatcgtgccggaagaatggctggccttcggggaccgcatcctcacgaccgacacc
ctgttcgagcagcgcgacctggggccgcgcatggcgatcattggactggggccgctgggg
gcggaaatcgcccaggcgctcgcccggctgggcgtggaggtggcggctttctcgagccgc
aaggaaatcgccggcctctccgaccccgccgtgaacgacgcgctgctcgggctgctgaaa
tcggagttcgttctgaacgtgggcgcggaggtgacgctgcgcgaggtgccggggggcatc
gaggtcaccaatggcagcgccacggtcgtggtggaccaggtcctcgcagccatgggacgg
cgcccgaacgtggagcacctcgggctggaaacgctgggcgtggaactggacaaggacggc
atgccgccggtggaccggcgcacggtgcaggtcggcgatctgccggtgttcatggccgga
gatgcgaacgacttccggcccctgctgcacgaggcggcggacgacgggcacatcgccggg
ctgaatgcgctggctcccgaagtgcgggggttccgtcgccgtatgccgctgtccatcgta
ttcacggagcccaacgcggcgaccgtcggcaggcgctacaaggacctgaagcgggacgaa
tcggtgaccggcaccgtcgatttcgcgcgccaggggcgggctcgcgtggcgcagcgcaac
cagggacgcctgagcctctacgcccagcgggacacaggccggctgctgggcgcggaaatg
tgcgccccggcgggcgagcacatggcccacctgctggcgctggccatggaccgggaactc
accgtgcatgacctcctgcggatgcctttctaccatcctgtactggaagaaggactgcgg
agcgcactacgagacgccgccagccagttgcccaagggcagcgattccgatctttccgcc
tgcgacgcctatgggtcgagcgccctggactga

KEGG   Acidovorax citrulli: Aave_2464Help
Entry
Aave_2464         CDS       T00451                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
aav  Acidovorax citrulli
Pathway
aav00010  Glycolysis / Gluconeogenesis
aav00020  Citrate cycle (TCA cycle)
aav00260  Glycine, serine and threonine metabolism
aav00280  Valine, leucine and isoleucine degradation
aav00310  Lysine degradation
aav00380  Tryptophan metabolism
aav00620  Pyruvate metabolism
aav00630  Glyoxylate and dicarboxylate metabolism
aav00640  Propanoate metabolism
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
aav01120  Microbial metabolism in diverse environments
aav01130  Biosynthesis of antibiotics
aav01200  Carbon metabolism
Module
aav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aav_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aave_2464
   00020 Citrate cycle (TCA cycle)
    Aave_2464
   00620 Pyruvate metabolism
    Aave_2464
   00630 Glyoxylate and dicarboxylate metabolism
    Aave_2464
   00640 Propanoate metabolism
    Aave_2464
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aave_2464
   00280 Valine, leucine and isoleucine degradation
    Aave_2464
   00310 Lysine degradation
    Aave_2464
   00380 Tryptophan metabolism
    Aave_2464
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aav04147]
    Aave_2464
Enzymes [BR:aav01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Aave_2464
Exosome [BR:aav04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Aave_2464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Biotin_lipoyl Pyr_redox FAD_oxidored GIDA FAD_binding_2 Thi4 FAD_binding_3 NAD_binding_8 Biotin_lipoyl_2 HI0933_like AlaDh_PNT_C Pyr_redox_3 GCV_H DUF2486 RnfC_N HlyD_D23 HlyD_3 DUF5525 DEC-1_N
Motif
Other DBs
NCBI-ProteinID: ABM33039
UniProt: A1TQ01
Position
2691031..2692884
Genome map
AA seq 617 aa AA seqDB search
MAVIDIKVPDIGDFSEVGVIEVLVKAGDTIKVEQSLITVESDKASMEIPSSHAGVVKEVK
VKVGDKVAEGSVVLTLEAADAAAAAAPAPASAPAAAAAPAQAAAPAPKAAAAPAPAAASF
GGNADVECDVLVLGGGPGGYSAAFRAADLGLKVVIVERYSTLGGVCLNVGCIPSKALLHV
AAVIDEVSHLKAAGIEFGAPKVDIDTLRGHKEKVIGKLTGGLAAMAKMRKVTTVRGVGQF
VGANHLEVEETTGARGQEKTGGKKVVAFKRAIIAAGSQAVHLPFMPNDPRVVDSTGALEL
KEVPKRMLILGGGIIGLEMGTVYSTLGARLDVVEMMDGLMQGADRDLVKVWQKMNAHRFD
NIMLKTKTVGAEATPEGIKVTFAAAEEGGKAPEPQVYDLVLQAVGRTPNGKKIGAEKAGV
AVTDRGFIDVDVQMRTNVPHIFAIGDIVGQPMLAHKAVHEAHVAAEVIAGELTGDKALAS
AAFNARVIPSVAYTDPEVAWVGLTEDQAKAQGIKVRKGLFPWTASGRAIANGRDEGYTKL
LFDDSPEAHGHGRILGGGIVGTHAGDMIGEIALAIEMGADAVDIGKTIHPHPTLGESIGM
AAEIAHGSCTDVPPQKK
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatcgacatcaaggtgcccgacatcggtgatttttccgaagtgggcgtgatc
gaagtgctggtgaaagccggcgacaccatcaaggtggaacagagcctcatcaccgtcgaa
tccgacaaggcatcgatggagattccgtcgagccatgccggcgtcgtcaaggaggtgaag
gtgaaggtcggcgacaaggtcgccgaaggttcggtggtgctgacgctggaggccgcggat
gcggctgccgctgcggcaccggcgcccgcatccgcacccgcggcggctgcagcgcctgcc
caggctgctgcaccggcccccaaggccgcagccgcgccggctccggccgcggcgagcttc
ggcggcaatgccgacgtcgaatgcgacgtgctcgtgctgggcggcggccccggcggctac
agcgccgccttccgcgcggccgacctgggcctgaaggtcgtcatcgtggagcgctattcc
accctgggcggcgtctgcctgaacgtgggctgcatcccgtccaaggcgctgctgcacgtg
gcggcggtgatcgacgaggtgagccacctcaaggcggccggcatcgagttcggtgcaccg
aaggtggacatcgacaccctgcgcggccacaaggaaaaggtcatcggcaagctgaccggc
ggtctggccgccatggccaagatgcgcaaggtgaccaccgtgcgcggcgtgggtcagttc
gtgggcgccaaccacctggaggtggaggaaaccaccggcgccaggggccaggagaagacg
ggcggcaagaaggtcgtggccttcaagcgcgcgatcatcgccgccggctcccaggccgtg
cacctgccgttcatgccgaatgatccgcgcgtggtcgattcgaccggcgcactggagttg
aaggaggtgccgaagcgcatgctgatcctgggcggcggcatcatcggcctggaaatgggc
accgtctattccaccctgggcgcgcgcctggacgtggtcgagatgatggacggcctgatg
cagggcgccgaccgcgacctggtcaaggtgtggcagaagatgaatgcccaccgcttcgac
aacatcatgctcaagaccaagacggtgggggccgaggccacgcccgagggcatcaaggtc
acgttcgccgcggcggaagagggtggcaaggcgcccgagccgcaggtctatgacctggtg
ctgcaggccgtgggccgcacccccaacggcaagaagatcggcgccgagaaggccggcgtg
gccgtgaccgaccgcggcttcatcgacgtggacgtgcagatgcgcaccaacgtgccgcac
atcttcgccatcggcgacatcgtgggccagcccatgctggcgcacaaggcggtgcacgaa
gcgcacgtggcggccgaggtcatcgccggtgaactgacgggcgacaaggcgctggcctcc
gctgcgttcaacgcccgcgtgatcccgagcgtggcctacaccgaccccgaagtggcctgg
gtgggcctgaccgaggaccaggccaaggcccagggcatcaaggtccggaagggcctgttc
ccctggacggcctccggccgcgccatcgccaacggccgcgacgagggctatacgaagctg
ctgttcgacgattcgcccgaagcccatggccacggcaggatcctgggcggcggcatcgtg
ggcacccatgccggcgacatgatcggcgagatcgccctggcgatcgagatgggcgcggat
gccgtggacatcggcaagaccatccatccgcacccgacgctgggcgagagcatcggcatg
gccgcggagatcgcgcacggctcctgcacggacgtgccgccgcagaagaagtga

KEGG   Acidovorax citrulli: Aave_3246Help
Entry
Aave_3246         CDS       T00451                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
aav  Acidovorax citrulli
Pathway
aav00010  Glycolysis / Gluconeogenesis
aav00020  Citrate cycle (TCA cycle)
aav00260  Glycine, serine and threonine metabolism
aav00280  Valine, leucine and isoleucine degradation
aav00310  Lysine degradation
aav00380  Tryptophan metabolism
aav00620  Pyruvate metabolism
aav00630  Glyoxylate and dicarboxylate metabolism
aav00640  Propanoate metabolism
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
aav01120  Microbial metabolism in diverse environments
aav01130  Biosynthesis of antibiotics
aav01200  Carbon metabolism
Module
aav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aav_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aave_3246
   00020 Citrate cycle (TCA cycle)
    Aave_3246
   00620 Pyruvate metabolism
    Aave_3246
   00630 Glyoxylate and dicarboxylate metabolism
    Aave_3246
   00640 Propanoate metabolism
    Aave_3246
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aave_3246
   00280 Valine, leucine and isoleucine degradation
    Aave_3246
   00310 Lysine degradation
    Aave_3246
   00380 Tryptophan metabolism
    Aave_3246
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aav04147]
    Aave_3246
Enzymes [BR:aav01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Aave_3246
Exosome [BR:aav04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Aave_3246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA FAD_binding_2 FAD_oxidored AlaDh_PNT_C HI0933_like NAD_binding_8 3HCDH_N FAD_binding_3 2-Hacid_dh_C Thi4 Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: ABM33808
UniProt: A1TS70
Position
complement(3582831..3584258)
Genome map
AA seq 475 aa AA seqDB search
MSKQFDVIVIGGGPGGYIAAIRAAQLGFNVACIDEWKNEKGGPAPGGTCTNVGCIPSKAL
LQSSEHFEHANKHFAEHGITATDVKIDVAKMIGRKDAVVKQNNDGILYLFKKNKVSFFHG
RGSFVKAAEGGYEIQVAGAAQETLVGKQIIVATGSNPRALPGVPFDEEKVLSNDGALRIG
ATPKKLGLIGAGVIGLEMGSVWRRVGADVTVLEGLPTFLGAVDEQIAKEAKKAFDKQGLK
IELGVKIGEIKTGGEGVTVAYTDAKGEARELAVDKLIVSIGRVPNTIGLNPEAVGLQLDE
RGAIVVDADCRTNLPGVWAVGDVVRGPMLAHKAEEEGVAVAERIAGQHGHVNFNTIPWVI
YTSPEIAWVGRTEQQLKADGVQYKAGTFPFLANGRARALGDTTGMVKFLADAVTDEILGV
HIVGPMASELISEAVVAMEFKASAEDIARICHAHPSLSEATKEAALAVDKRTLNF
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacaattcgacgtcatcgtcatcggcggcggtcccggtggctacatcgccgcc
atccgcgccgcccagctgggcttcaacgtggcctgcatcgacgagtggaagaacgagaag
ggcggccccgcgcccggcggcacctgcacgaacgtgggctgcatcccctccaaggcgctg
ctgcagtcctccgagcatttcgagcatgccaacaagcatttcgccgagcacggcatcacg
gccaccgatgtgaagatcgacgtggccaagatgatcggccgcaaggacgccgtcgtgaag
cagaacaacgacggcatcctctacctgttcaagaagaacaaggtcagcttcttccatggc
cgcggctccttcgtgaaggccgcggagggcggctacgagatccaggtggccggcgccgcg
caggaaaccctggtgggcaagcagatcatcgtggccacgggctccaacccccgcgcgctg
cccggcgtgcccttcgacgaagagaaggtgctctccaacgacggcgcgctgcgcatcggc
gccacgccgaagaagctgggcctgatcggtgccggcgtgatcggcctggagatgggctcc
gtgtggcgccgcgtgggtgccgacgtgacggtgctcgaaggcctgccgacgttcctgggc
gctgtcgatgagcagatcgccaaggaagccaagaaggccttcgacaagcagggcctgaag
atcgagctgggcgtgaagatcggcgagatcaagaccggcggcgagggcgtcacggtggcc
tacaccgacgccaagggcgaagcccgcgagctggcggtggacaagctcatcgtctccatc
ggccgcgtgcccaacaccatcggcctgaatcccgaggccgtgggcctgcagctcgacgag
cgcggcgccatcgtggtcgatgccgactgcaggaccaacctgcccggcgtgtgggcggtg
ggcgacgtggtgcgcggcccgatgctggcgcacaaggccgaggaagagggcgtggcggtg
gccgagcgcatcgcgggccagcacggccacgtgaacttcaacaccatcccctgggtcatc
tacaccagccccgagatcgcctgggtgggccgcaccgagcagcagctcaaggccgacggc
gtgcagtacaaggctggcacgttcccgttcctggcgaacggccgtgcccgcgcgctgggc
gacacgaccggcatggtcaagttcctggccgatgcggtcacggacgagatcctgggcgtg
cacatcgtgggcccgatggccagcgagctgatctccgaggccgtggtggccatggagttc
aaggccagcgccgaagacatcgcgcgcatctgccacgcccacccctcgctgtccgaggcg
accaaggaagcggccctggccgtggacaagcgcacgctcaacttctga

DBGET integrated database retrieval system