KEGG   Acidovorax citrulli: Aave_2463Help
Entry
Aave_2463         CDS       T00451                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aav  Acidovorax citrulli
Pathway
aav00010  Glycolysis / Gluconeogenesis
aav00020  Citrate cycle (TCA cycle)
aav00620  Pyruvate metabolism
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
aav01120  Microbial metabolism in diverse environments
aav01130  Biosynthesis of antibiotics
aav01200  Carbon metabolism
Module
aav_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aave_2463
   00020 Citrate cycle (TCA cycle)
    Aave_2463
   00620 Pyruvate metabolism
    Aave_2463
Enzymes [BR:aav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Aave_2463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H PYNP_C NQRA RnfC_N HlyD_3 FAP
Motif
Other DBs
NCBI-ProteinID: ABM33038
UniProt: A1TQ00
Position
2689314..2691017
Genome map
AA seq 567 aa AA seqDB search
MALIDIKVPDIGDFDAVGVIELLVKPGDTVKAEQSLITVESDKASMEIPSSHAGVVKEVK
VKIGDQVSEGSVIVVVEAEGEGAQPAAAPAAKAEAPAPASAAASAPAPAAPAAAPAAAGP
IDVKVPDIGDFKDVAVIELLVKVGDTVKEEQSLFTVESDKASMEIPSPAAGVVKELKIKI
GDKVNVGDLVAVLEGTAGASSAAPAAAAPVDRAAPQSEPDARAPRQLPAEEAAPQAGAQA
SSPSPAPAPHAPGAAPIGLPHASPSVRKFARELGVPLEELKGSGPKGRITQEDVQAFTRQ
VMAGGVQTKAQAAKPPAGGGSGVGMDLLPWPKVDFAKFGGVERKDLSRIKKISGANLHRN
WVMIPHVTNNDEADITELEAFRVSTNKENEKSGVKVTMLAFVIKAVVAALKKFPEFNTSL
DGDTLVYKQYFHIGFAADTPNGLVVPVLKDADKKGILQISQEMGELAKKARDGKLGAADM
QGGCFSISSLGGIGGTHFTPIINAPEVAILGLSKGQMKPVWDGKQFVPRLVLPLSLSYDH
RVIDGASAARFNAYLGQVLADYRRILL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggcactgattgacatcaaggtcccggacatcggggatttcgacgccgtcggcgtgatc
gaactgctggtgaagcccggcgacacggtgaaggccgagcagtcgctcatcaccgtggag
tccgacaaggcttccatggagattccttccagccacgccggcgtggtgaaggaggtcaag
gtcaagatcggcgaccaggtgagcgaaggctcggtgatcgtcgtggtcgaggccgaaggc
gagggcgcgcagcccgcggcggcgcctgccgcgaaagcggaagcgcccgcacccgcatcg
gccgcggcgtccgcgcctgcacctgccgcgcccgcggccgccccggctgccgccggcccg
atcgatgtgaaggtgccggacatcggcgacttcaaggacgtggcggtgatcgaactgctg
gtgaaggtcggcgatacggtcaaggaagagcagtcgctcttcaccgtcgaatcggacaag
gcctccatggagattccgtcgcccgccgccggcgtggtgaaggagctgaagatcaagatc
ggcgacaaggtgaacgtgggtgacctcgtggccgtgctcgaaggcaccgcgggcgcgtcc
tcggcggcgcctgccgctgccgctccggtggaccgcgccgcgccgcagtccgagcccgac
gcgcgcgccccgcgccagctgccggccgaggaggccgccccccaggcgggagcgcaggca
tcctcgccgtctcccgcgcccgcgccgcatgccccgggcgctgcgcccatcggcttgccg
catgcatcgccttcggtgcgcaagttcgcgcgtgaactgggcgtgccgctggaagagctc
aagggctccggccccaagggtcgcatcacccaggaggacgtgcaggccttcaccaggcag
gtgatggcgggcggcgtgcagaccaaggcccaggcggccaagccacctgccggcggcggc
tccggcgtgggcatggacctgctgccctggccgaaggtggacttcgccaagttcggtggc
gtggagcgcaaggatctctcgcgcatcaagaagatcagcggcgccaacctgcaccgcaac
tgggtgatgattccccacgtcaccaacaacgacgaagccgacatcaccgaactggaagcc
ttccgcgtctccaccaacaaggagaacgagaagtctggcgtgaaggtgacgatgctcgcc
ttcgtgatcaaggccgtggtggccgcgctcaagaagttccccgagttcaacaccagcctg
gacggcgacacgctcgtctacaagcagtacttccacatcggtttcgcggcggacacgccg
aacggcctcgtggtgcccgtgctgaaggatgccgacaagaagggcatcctgcagatcagc
caggaaatgggcgagctcgccaagaaggcccgcgacggaaagctcggcgcggccgacatg
cagggcggctgcttctcgatctcgtcgctcggcggtatcggcggcacgcacttcacgccc
atcatcaacgcgcccgaagtggccatcctgggcctctcgaagggccagatgaagcccgtg
tgggacggcaagcagttcgtgccgcgcctggtgctgccgctgtcgctctcctacgatcac
cgcgtgatcgacggagcgtctgccgcgcgcttcaacgcctacctgggccaggtgctggcg
gattaccgccgcatcctgctgtga

DBGET integrated database retrieval system