KEGG   Acidovorax citrulli: Aave_2664Help
Entry
Aave_2664         CDS       T00451                                 

Definition
(GenBank) Aldehyde dehydrogenase (NAD(+))
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
aav  Acidovorax citrulli
Pathway
aav00010  Glycolysis / Gluconeogenesis
aav00053  Ascorbate and aldarate metabolism
aav00071  Fatty acid degradation
aav00280  Valine, leucine and isoleucine degradation
aav00310  Lysine degradation
aav00330  Arginine and proline metabolism
aav00340  Histidine metabolism
aav00380  Tryptophan metabolism
aav00410  beta-Alanine metabolism
aav00561  Glycerolipid metabolism
aav00620  Pyruvate metabolism
aav00625  Chloroalkane and chloroalkene degradation
aav00903  Limonene and pinene degradation
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
aav01120  Microbial metabolism in diverse environments
aav01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aave_2664
   00053 Ascorbate and aldarate metabolism
    Aave_2664
   00620 Pyruvate metabolism
    Aave_2664
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Aave_2664
   00561 Glycerolipid metabolism
    Aave_2664
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Aave_2664
   00310 Lysine degradation
    Aave_2664
   00330 Arginine and proline metabolism
    Aave_2664
   00340 Histidine metabolism
    Aave_2664
   00380 Tryptophan metabolism
    Aave_2664
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Aave_2664
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Aave_2664
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Aave_2664
Enzymes [BR:aav01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Aave_2664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABM33236
UniProt: A1TQJ8
Position
complement(2923981..2925423)
Genome map
AA seq 480 aa AA seqDB search
MARMQYHHIANAAVPSTGGRTLPVIDPSDGQPYDEIQRGTAEDIDAAVRAARHCHDTAWR
TLAPAERGRLLTRLSQVVAHHAEELADIERRDCGKPTRQARADAVALARYFEFYAGACDK
LHGDTIPYMDGYSVLTWREPHGVTGHIVPWNYPMQIFGRCVGGALAAGNTCVVKPSEDAC
LSLLRVAQLAAEAGFPPGAINIVTGYGHEVGEALARHPGIDHISFTGSPRIGTLIQQAAA
ERHCPVTLELGGKSPQILFADADLDAALPAVVNAIVQNAGQTCSAGSRVLIDALIYERVL
ERLAGLFEALRVGPAAMDLDLGPLIRQSQQQRVWDFLSDAQVAGIPVMAQGTVVDGAPQT
GFYQAPTLLRDVPPDHRLAQEEIFGPVLSAMPFEDEDHAAQLANATRFGLVAGVWTRDGG
RQFRMARRIASGQVFINNYGAAGGVELPFGGVKSSGHGREKGLEALHGFTTLKTVAIRHG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcatgcagtaccaccacattgccaatgccgcggtaccctccaccggcggccgc
accctgccggtgatcgacccctccgacggccagccctacgacgagatccagcgcggcacg
gccgaggacatcgacgcggccgtgcgcgcggcgcggcactgtcacgacaccgcgtggcgc
acgctcgcaccggccgagcggggccggctgctgacgcgcctgtcgcaagtggtggcgcac
catgcggaggaactggcggacatcgaacggcgcgactgcggcaagcccacccggcaggcg
cgtgccgatgccgtcgcgctggcgcgctatttcgagttctatgccggtgcctgcgacaag
ctccacggcgacaccatcccctacatggacggctacagcgtgctcacctggcgcgagccg
cacggcgtgacggggcacatcgtgccctggaactaccccatgcagatcttcggacgctgc
gtgggcggcgcgctggcggcgggcaacacctgcgtggtcaagccgtcggaggacgcctgc
ctctcgctgctgcgggtcgcgcagctggccgccgaggcgggttttccgccgggcgcgatc
aacatcgtgacgggctacgggcacgaggtgggcgaggcgctcgcgcgccaccccggcatc
gaccacatcagtttcaccggcagcccgcgcatcggcacgctgatccagcaggccgcggcc
gagcggcactgcccggtcacgctggagctgggcggcaagagcccgcagatcctgttcgcg
gatgccgacctggacgccgccctgcccgcggtcgtcaacgccatcgtgcagaacgcgggc
cagacctgctcggccggttcgcgggtgttgatcgatgcgctcatctacgaacgggtgctg
gagcggctggccggcctgttcgaggcgctgcgcgtcgggcccgcggccatggacctcgac
ctggggccgctgatccgccagagccagcagcagcgcgtgtgggatttcctctccgacgcg
caggtggccggcatccccgtcatggcccagggcaccgtggtggacggcgcgccgcagacg
ggcttctaccaggcgcccacgctgctgcgcgacgtgccaccggaccatcgcctcgcgcag
gaggaaatcttcggccccgtgctctcggccatgcccttcgaggacgaggaccacgccgcg
cagttggccaacgccacgcgcttcggcctcgtggccggcgtgtggacgcgcgacggcggg
cgccagttccgcatggcccggcgcatcgccagcggccaggtgttcatcaacaactacggc
gccgccggcggcgtggaactgcctttcggcggagtgaagtccagcggccatggccgcgaa
aagggcctggaggcgctgcacggcttcaccacgctcaagaccgtggccatccggcacgga
tga

KEGG   Acidovorax citrulli: Aave_2805Help
Entry
Aave_2805         CDS       T00451                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
aav  Acidovorax citrulli
Pathway
aav00010  Glycolysis / Gluconeogenesis
aav00053  Ascorbate and aldarate metabolism
aav00071  Fatty acid degradation
aav00280  Valine, leucine and isoleucine degradation
aav00310  Lysine degradation
aav00330  Arginine and proline metabolism
aav00340  Histidine metabolism
aav00380  Tryptophan metabolism
aav00410  beta-Alanine metabolism
aav00561  Glycerolipid metabolism
aav00620  Pyruvate metabolism
aav00625  Chloroalkane and chloroalkene degradation
aav00903  Limonene and pinene degradation
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
aav01120  Microbial metabolism in diverse environments
aav01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aave_2805
   00053 Ascorbate and aldarate metabolism
    Aave_2805
   00620 Pyruvate metabolism
    Aave_2805
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Aave_2805
   00561 Glycerolipid metabolism
    Aave_2805
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Aave_2805
   00310 Lysine degradation
    Aave_2805
   00330 Arginine and proline metabolism
    Aave_2805
   00340 Histidine metabolism
    Aave_2805
   00380 Tryptophan metabolism
    Aave_2805
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Aave_2805
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Aave_2805
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Aave_2805
Enzymes [BR:aav01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Aave_2805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABM33373
UniProt: A1TQY5
Position
3078674..3080146
Genome map
AA seq 490 aa AA seqDB search
MTFPIIERLARDGRLDRLFIDGGWRRPEGTSRATITDPSTEQPLADIALGDARDAAAAIA
AARRAFPAWSAATPRQRADLLGRLHALVLERAESFAQAISLEMGSAIGVARGAQVPIAAE
HLRVARDLAASYPFVTHREGTAIVREAIGVCGLITPWNWPLYQITAKVGPALAAGCTVVL
KPSELSPFSAMLFAEAVQDAGIPSGVFNLVAGEGPEVGAALASHPDVDMVSITGSTRAGV
LVAQAAAPTVKRVAQELGGKSPNVILPDADLSVAVPAGVAAGMRNVGQSCSAPTRMIVPR
ARLAEAERLAAEAVSRMVVGDPRSERTTHGPVANRAQFHRVQEMIAAGVEEGARLVCGGP
GRPAGLEHGFYARPTIFSDVHPRMRIAQEEIFGPVLVLIPYDTVDEAVDIANDTIYGLGA
HVQGADPAAARAVAMRIRAGQVHINNPAWSPHAPFGGYKRSGNGREYGVEGLHEYLETKA
ILGWAGGAPA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgacctttcccatcatcgaacgcctggcccgggacggccgcctggatcgcctcttcatt
gacggcggctggcggcggccggaggggacgtcccgggcgaccatcaccgatccttccacg
gagcagccgctggcggacatcgcgctgggcgacgcccgggacgccgcggctgcgatcgcc
gcagcccggcgcgccttcccggcctggtccgcggccacgccccggcagcgcgcggatctc
ctgggccggctgcatgccctggtcctggagcgcgcggaatcgttcgcccaggcgatctcg
ctggaaatgggatccgccatcggcgtggcgcgcggcgcgcaggtgccgatcgccgcggaa
cacctgcgcgtggcccgcgacctggcggccagctatcccttcgtcacccaccgcgagggc
acggccatcgtgcgcgaggccatcggcgtctgcggcctcatcacgccctggaactggccg
ctctaccagatcaccgccaaggtggggccggcgctggccgcgggatgcaccgtggtgctc
aagcccagcgaactgtccccgttcagcgcgatgctcttcgccgaggcggtgcaggacgcc
gggatcccctcgggggtgttcaatctcgtcgccggcgaaggccccgaggtgggggctgcg
ctcgcgtcgcatcccgacgtggacatggtctcgatcaccggctccacgcgggccggcgtc
ctcgtggcccaggcggccgcgccgacggtcaagcgcgtggcccaggaactgggcggaaag
tcccccaatgtcatccttccggatgccgatctttccgtggccgtgccggccggcgtggcg
gcgggcatgcgcaacgtgggccagtcctgcagtgccccgacgcgcatgatcgtgccgcgc
gcccggctggccgaggccgagcgcctcgcggccgaggccgtgtcgcgcatggtcgtcggg
gatccccgttcggagcggaccacgcacggcccggtggccaatcgggcccagttccaccgc
gtgcaggaaatgatcgccgccggcgtcgaggaaggcgcgcgcctggtctgcggcggcccc
ggccgtccggcgggcctggagcacggcttctacgcccgtccgaccatcttctccgacgtg
catccgcggatgcggatcgcccaggaggaaatcttcgggccggtgctcgtcctcattccc
tacgacacggtcgatgaagccgtggacatcgccaacgacacgatctacggcctgggcgcc
cacgtgcagggcgccgatcccgcggcggcccgggcggtcgcgatgcggatccgggccggg
caggtgcacatcaacaacccggcctggagcccgcacgcccccttcggcggctacaagcgc
tcgggcaacggacgcgaatacggcgtcgaggggctccacgagtacctcgaaaccaaagcc
atcctgggatgggccggaggcgcacccgcatga

DBGET integrated database retrieval system