KEGG   Acidovorax citrulli: Aave_2752
Entry
Aave_2752         CDS       T00451                                 

Definition
(GenBank) conserved hypothetical protein
Organism
aav  Acidovorax citrulli
SSDB
Motif
Pfam: DUF5471 TarH
Other DBs
NCBI-ProteinID: ABM33320
UniProt: A1TQT2
Position
complement(3024781..3026166)
AA seq 461 aa
MSPFALPRLRLRPVLVAACTAAALLAGASPASAQPVSSSSLYYRMGGGSPGGAAPNRGMM
ANQFSAGVRANYSCGRFDIGASWSSLMNGISNLGATISGAIQAGIAALPLYFLQRAQPGL
YQLFQNFSQKADLLVASSLKSCEDMEALIKAGKDPYEDYVALAKGDAWKIAASTGGNVVD
AKIAINKNEVAQRAGLPWVFGTRAGGAGTAPIQPVRDLAVAGYNLTINKTASTISTANYG
SSSLASTRLVQAFKTPDDLAKWSTEVLGDQKIYLCTQDSSCPTATSTVTATGLGPKFEQE
LESVLPTMRTLAEANTVGQADLVKVSAPGMAVSPQLMDAMRKLPKDVRSVAVNRLAQEIA
MHKVVDKALVARNALISGLSLPQASANGQVNSEVQTKIDRLTQYINDLMYEFRIRKEMTG
ETALAIMQNQLAAGASSNAVTGGSRADPAPVFDGRVEVPKQ
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtcacccttcgccctgccgcggctgcgcctgcgcccggtgctcgtcgctgcatgcacg
gccgccgcgctgctcgccggcgcgtcccccgcgtccgcgcagcctgtctcttcgtccagc
ctctactaccgcatgggcggcggatctcccggcggcgccgcgcccaaccgcggaatgatg
gcaaaccagttcagcgccggcgtgcgggccaactactcgtgcggacggttcgacatcggt
gcgtcctggtcgtcgctcatgaacggcatctccaacctgggcgccaccatctccggcgcc
atccaggcgggcattgccgcacttccgctgtacttcctgcagcgggctcagcccgggctg
taccaactcttccagaatttctcgcagaaggccgatctgctggtggcatcctcgctcaag
tcctgcgaggacatggaggcgctgatcaaggccggcaaggatccctacgaggactacgtg
gcgttggccaagggcgatgcctggaagatcgctgcctccaccggcggtaacgtcgtcgat
gccaagatcgccatcaacaagaacgaggtcgcccagcgcgcgggcctgccctgggtgttc
ggaacccgggcaggcggcgccggcaccgcgcccattcagccggtgcgtgacctggccgtg
gccggctacaacctgaccatcaacaagacggccagcacgatctcgacagccaactacggc
agttcctccctcgcgtccacccgcctggtccaggcgttcaaaacgccggacgacttggcg
aagtggagcaccgaggtcctgggcgatcagaagatctacctgtgcacgcaggactccagc
tgcccgaccgcgacttccacggtgacggccaccggcctgggcccgaagttcgagcaggag
ctcgaatccgtgcttccgacgatgcggacgctcgccgaggcgaacacggtcggacaggcc
gacctggtcaaggtgagcgccccgggcatggccgtgagcccgcagctgatggatgcgatg
cgcaagctgccgaaggatgtgcgatccgtggccgtgaaccgcctggcgcaggagatcgcc
atgcataaggtggtggacaaggccctggtggcgcgcaacgcgctgatttccgggctgagc
ttgccgcaggcgagcgcaaacggccaggtcaacagcgaggtgcagaccaagatcgaccgc
ctgacccagtacatcaatgacctcatgtacgagttccggatccgcaaggagatgaccggc
gaaacagccctggcgatcatgcagaaccaactggcggcaggcgcttcgtccaacgcggtc
accggcggctcgcgggccgatcccgcgccggtcttcgacggccgcgtcgaggttcccaag
caatga

DBGET integrated database retrieval system