KEGG   Acidovorax citrulli: Aave_2755
Entry
Aave_2755         CDS       T00451                                 
Name
(GenBank) conserved hypothetical protein
Organism
aav  Acidovorax citrulli
SSDB
Motif
Pfam: TraC_F_IV AAA_10 FtsK_SpoIIIE DUF5934 P-loop_TraG T2SSE DUF87 AAA_22 MazG_C
Other DBs
NCBI-ProteinID: ABM33323
UniProt: A1TQT5
Position
complement(3027900..3030794)
AA seq 964 aa
MKKWFDVLLGRSSSASGERAAPSPAASGAPGKPMTLADRRRMAARPPSFTELLPYVCYSP
AEQVFAMRDGATLGAMFELSPVATEAQPLTYLQERARKVQEALQAIPEAEGSPWIVQFFL
SDDRNVEILNQQLHDYILSQHKDNPRRAQEVISSEYTQSVLAEMRKHLDQVSRPQGLFTD
TLVTGQVWRGQQRRVRCCIYRKFTGLANEPAEPIKQMEGAATTLFATFTEAGVTARRCNG
RDFYEWLLPFFNRDVPWAPTPGELLQKAPYPGEMPEGMFDWDLAESLSLSQPRADVDAGL
FEFDGVPVKALTLQNLRGQPAIGHFSAELTSGKESYARFDRLPPGSMLSMTVTVTPQHLV
ERKVERIRDKSRAKTAIAMEAHAECERVLQRMVNGDKLYPMFVTLYLTGRDRTELDAAIS
EVNALLVPTGMRFVDPRHDLVPLDSFVRALPFNFDPDFDQRYMLRSRLTFASHIAAIAPV
YGRSRGTPHPGMWYWNRGGEPLFMDPLNKLDRKKNAHMLVLGPTGAGKSATLNYQAMFSM
AVHRPRLVIVDAGMSFDLLVKDMAAKGLSVHRVRLTMDCEESLPPFVHGARLLQDKEIMD
SFHAAENQAKRNAGLSVDEAADGGKSSKIMETVDTVIEAQAADTDSDDDGVDEKRDLLGE
MLIAAIMMITGGEPAEVARMSRADRYLVTRAIIKAALQASKDGHKHPLTQDVAIALMAMH
NDPTLSTHRQARAEEMGQSMMTFTQGLRGKLFNRYGGDWPDADVTLVEMGTLTKDGYGDA
LAVAYTSLIDSVQSRGEQFQDQGRPLIMLTDEGHLITTNDLLGPKVAKATKMWRKLNIWF
WLATQNLKDFPDSMERVLSMCEFWMLLTMDKSEIEEVARFRNLTPEQRHMMESAVKEPPK
YTEGVLISATGQWLFRNVPPAVPIALAMTEGHEKAHRRRLMDAHGCTELDAAYMVAEKLA
EARA
NT seq 2895 nt   +upstreamnt  +downstreamnt
atgaagaagtggttcgacgtgctgcttggccgctcctcgtcggcaagcggggagcgcgct
gcgccgtcgcccgcagcctccggcgcgcctggcaagccgatgaccttagcggaccgtcgc
aggatggcggccaggccgccgtcgttcaccgagcttctgccgtacgtttgctattcgccg
gcggagcaggtgtttgccatgcgcgatggcgccaccctgggcgccatgttcgagctcagt
ccggtggctaccgaggcgcagccgctcacctacctgcaggagcgcgcccgcaaggtgcag
gaggccctgcaggcgatccccgaggccgaaggctcgccctggatcgtgcagttcttcctg
agcgacgaccgcaacgtcgagatcctgaaccagcagctgcacgactacatcctgtcccag
cacaaggacaacccgcgccgggcccaggaggtgatttcctccgagtacacccagtccgtc
ctggccgagatgcgcaagcacctggaccaggtgtcccgcccgcagggcctgttcaccgac
accctcgtcaccggccaggtctggcggggccagcagcgccgcgtgcgctgctgcatctac
cgcaagttcaccggcctggcgaacgagccagccgagccgatcaagcagatggagggcgcc
gccacgacgttgttcgcgacgttcaccgaggcgggcgtcaccgcgcgccgctgcaacggc
cgagacttctacgaatggctcctgcccttcttcaatcgcgatgttccgtgggcacccacg
ccgggtgagctgttgcagaaggcgccctacccgggcgagatgcctgaaggcatgttcgac
tgggacctggccgagtcgctgtcgctcagccagccgcgtgcggacgtcgatgccggtctc
ttcgagttcgacggcgtgcccgtgaaggctctgacgctgcagaacctgcgtggccagccc
gccatcgggcacttctcggcggagctcaccagcggcaaggagagctatgcgcgcttcgac
cgcctcccacccggatccatgctgtcgatgaccgtcaccgtgacgccgcagcacctggtg
gagcggaaggtggaacgcatccgcgacaagtcgcgggcgaagaccgccatcgccatggag
gcgcacgccgagtgcgagcgggtgctccagcgcatggtgaacggcgacaagctctacccg
atgttcgtcacgctatacctcacaggccgcgatcggaccgagctcgacgccgcgatctcg
gaggtgaatgcgctgctcgttcccaccggaatgcgcttcgtcgatccgcgccatgatctg
gtgccgctcgacagcttcgtgcgcgcgctgcccttcaacttcgatccggacttcgaccag
cggtacatgctgcgctcgcgtctcacgttcgcgagccacatcgctgcgatcgcgcccgtg
tatggccgctcccgcggcacgccgcaccccggcatgtggtactggaaccgcggcggcgag
ccgttgttcatggacccgctcaacaagctcgaccgcaagaagaacgcgcatatgttggtg
ctcgggcccacgggcgcgggcaagtcggcgacgctgaactaccaggccatgttctctatg
gccgtccaccgaccgcgcctggtgatcgtcgacgccggcatgtccttcgacctgctggtg
aaggacatggccgccaagggcctgtcggttcaccgggtgcggctgaccatggactgtgag
gagtccttgccgccgttcgtgcacggtgcccggctgcttcaggacaaggagatcatggat
tccttccatgccgcagagaaccaggcgaagcgcaatgcgggcctgagcgtggacgaggcg
gcggacggcggcaagagctcgaagatcatggagactgtcgataccgtgatcgaggcccag
gcagcagacacggatagcgacgacgacggcgttgatgagaagcgagatctgttgggcgag
atgctgatcgccgccatcatgatgatcaccggaggcgagccggcagaggtcgcacgcatg
agccgtgccgaccgctacctcgtgacccgggccatcatcaaggcggcgctgcaggcatcc
aaggacggccacaagcatccgctgacccaggacgtcgccatcgcgctcatggcgatgcac
aacgacccgaccctctcgacgcaccgccaggcgcgcgcggaagaaatggggcagtcgatg
atgacgttcacccagggactgcgtggcaagctcttcaaccgctacggcggcgactggcct
gacgccgacgtgaccctggtggagatgggcactctcacgaaggatggctatggagatgcg
ctcgccgtcgcctacaccagcctgatcgattcggtccagtcgcgcggcgagcagttccag
gaccagggccggccgctcatcatgctgaccgacgagggccacctgatcaccaccaacgat
ctgctgggcccgaaggtggccaaggccaccaagatgtggcgcaagctgaacatctggttc
tggctcgctacgcagaacctgaaggacttcccggacagcatggagcgcgtgctatcgatg
tgcgaattctggatgctgctcacaatggacaagtcggagatcgaggaggtggcgcgcttc
cgtaatctcacccccgagcagcgacacatgatggagtcggccgtgaaggagccgcccaag
tacaccgagggcgtgctcatcagcgcgaccggccagtggttgttccggaacgtgccgccc
gctgttcccatcgctctcgcgatgacggaagggcacgagaaggcacaccgtcggcgcctc
atggatgcccacggctgtaccgagctcgatgcggcctacatggtggccgagaagctggcg
gaggcacgggcatga

DBGET integrated database retrieval system