KEGG   Acidovorax citrulli: Aave_2765
Entry
Aave_2765         CDS       T00451                                 

Definition
(GenBank) hypothetical protein
Organism
aav  Acidovorax citrulli
SSDB
Motif
Pfam: DUF2859 NaeI
Other DBs
NCBI-ProteinID: ABM33333
UniProt: A1TQU5
Position
complement(3039042..3039695)
AA seq 217 aa
MTMQRRSILRAAALLAGHLPGLAAAAAQGRDGADVALQIIHDSGRGVPMAPYLAQLAGDA
DDPGALSGVPFPFVSRRLRGGVLQVEGTAVFQPEWLTEAVFVVAADDVSFRWLAYNHARL
VQMQAVGVVVQAGTAAAYQVMQRLARPMRLAPDSGEWVSERLAAAGADVYPVLVQTDGRA
YQILTQDTGPAASGRSSLEQPMPAHVQKLPRQVGGRR
NT seq 654 nt   +upstreamnt  +downstreamnt
atgacgatgcaacgacgaagcattcttcgcgctgctgcgttgttggccgggcacctgccc
ggcctggccgctgctgcagcgcagggccgcgatggcgcagacgtcgccctgcagatcatc
cacgacagcggccgcggcgttccgatggccccttacctcgcccagctggccggcgatgcc
gatgacccgggcgccctctccggcgtccccttcccattcgtgagccgccgcctgcgcggc
ggcgtgctgcaggtggagggcacggcggtgttccagcccgaatggctgaccgaggccgtg
ttcgtagtcgccgccgacgacgtgtcgttccggtggcttgcgtacaaccatgcccgcctg
gtgcagatgcaggcagttggggtggtggtccaggccgggaccgctgccgcctaccaggtg
atgcagcggttggcccgcccaatgcgcctggctccggattctggcgagtgggtgtccgag
cggctggccgccgccggcgccgacgtctacccggtcctggtgcagacggatggtcgtgcg
taccagatcctgacgcaggataccggccccgctgcttcgggacggtcatcgctggagcag
cctatgcctgcccacgtccagaagctgccccggcaggtgggagggcgtcgatga

DBGET integrated database retrieval system