KEGG   Acidovorax citrulli: Aave_2860Help
Entry
Aave_2860         CDS       T00451                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
aav  Acidovorax citrulli
Pathway
aav00630  Glyoxylate and dicarboxylate metabolism
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
aav01120  Microbial metabolism in diverse environments
aav01200  Carbon metabolism
Module
aav_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Aave_2860
Enzymes [BR:aav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Aave_2860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABM33428
UniProt: A1TR40
Position
complement(3151735..3153054)
Genome map
AA seq 439 aa AA seqDB search
MPQTFNEQLSREQQIAALEKDWAQNPRWKGIKRGYGAADVVRLRGSFQVEHTLARRGAEK
LWNLVHNEPYVNCLGALTGGQAMQQVKAGIKAIYLSGWQVAADNNEYAAMYPDQSLYPVD
SVPKVVERINNSFTRADEIQWAKGVNPGDAGFIDYHAPIVADAEAGFGGVLNAYELMKAM
IRAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLIAARMAADVYGVPTLVIARTDA
EAADLITSDYDENDKPFLTGERTAEGFYKTRKGIDQAISRAVAYADYADLVWCETGTPDL
EFARKFAEAVHAKHPGKLLAYNCSPSFNWKKNLDDATIAKFQRELGAMGYKYQFITLAGI
HSMWFNMFDLAQDYVKRGMSAYVEKVQEPEFAARERGYTFVSHQQEVGTGYFDEVTTVIQ
GGKSSVTALTGSTEEEQFH
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgccccaaaccttcaatgagcaactgagccgtgaacagcaaatcgccgccctggaaaaa
gactgggcgcagaacccccgctggaaggggatcaagcgcggctacggcgccgccgatgtc
gtgcggctccgcggctccttccaggtcgaacacacgctggcgcgccgcggcgccgaaaag
ctgtggaacctcgtccacaacgaaccctacgtgaactgcctcggcgcgctgaccggcggc
caggccatgcagcaggtcaaggccggcatcaaggcgatctacctgtccggctggcaggtg
gccgccgacaacaacgagtacgccgcgatgtaccccgaccagtcgctgtaccccgtggac
tcggtgccgaaggtcgtggaacgcatcaacaacagcttcacccgtgccgacgagatccag
tgggccaagggcgtgaaccccggcgacgcgggcttcatcgactaccacgccccgatcgtg
gccgatgccgaggccggcttcggcggcgtgctcaacgcctatgaactcatgaaggccatg
atccgcgccggcgccgcgggcgtgcacttcgaagaccagctcgcctcggtcaagaagtgc
ggccacatgggcggcaaggtgctggtgcccacgcaggaagccgtgcagaagctcatcgcc
gcgcgcatggctgccgacgtgtacggcgtgcccaccctggtcatcgcccgcaccgacgcc
gaggccgcggacctcatcaccagcgattacgacgagaacgacaagcccttcctgaccggc
gagcgcaccgccgaaggcttctacaaaacccgcaagggcatcgaccaggccatcagccgt
gccgtggcctacgccgactacgcggatctcgtctggtgcgaaaccggcacgccggacctg
gagttcgcccgcaagttcgccgaggccgtgcatgccaagcacccgggcaagctgctcgct
tacaactgctcgccgtcgttcaactggaagaagaacctcgacgacgcgaccatcgccaag
ttccagcgcgaactgggcgccatgggctacaagtaccagttcatcacgctggccggcatc
cacagcatgtggttcaacatgttcgacctggcgcaggactacgtgaagcgcggcatgtcc
gcctatgtggaaaaggtgcaggagcccgaattcgcggcccgcgagcgcggctataccttc
gtgtcgcaccagcaggaggtgggcacgggctacttcgacgaggtgaccaccgtgatccag
ggcggaaagtccagcgtgaccgcgctgaccggctccaccgaggaagagcagttccactga

DBGET integrated database retrieval system