KEGG   Acidovorax citrulli: Aave_3126Help
Entry
Aave_3126         CDS       T00451                                 

Definition
(GenBank) butyryl-CoA:acetate CoA transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
aav  Acidovorax citrulli
Pathway
aav00072  Synthesis and degradation of ketone bodies
aav00280  Valine, leucine and isoleucine degradation
aav00650  Butanoate metabolism
aav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Aave_3126
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Aave_3126
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Aave_3126
Enzymes [BR:aav01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     Aave_3126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: ABM33690
UniProt: A1TRV2
Position
complement(3450158..3450799)
Genome map
AA seq 213 aa AA seqDB search
MPWTQDQMAARAAQELEDGFYVNLGIGIPTLVANHTGDKEVWLQSENGMLGIGPFPTEDA
VDADLINAGKQTVTTIPGSSIFGSDQSFAMIRGGKINLSILGAMQVSEKGDLANWMIPGK
MVKGMGGAMDLVAGVKRVIVLMEHVARKKDGTEDLKILPACTLPLTGVGVVDRIITDLAV
LDVTPGGLKVVELAPGVDFDALQAKTGVKLLPA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgccctggacccaagaccagatggccgcgcgcgcggcgcaggaactggaagacggtttc
tacgtgaacctcggcatcggcattcccacgctggtggccaaccacaccggcgacaaggaa
gtgtggctgcagtccgagaacggcatgctgggcatcggcccgttcccgaccgaggacgcg
gtggacgccgacctcatcaacgccggcaagcagaccgtgaccaccattcccgggtcgtcc
atcttcggcagcgaccagtcgttcgccatgatccgcggcggcaagatcaacctctcgatc
ctgggcgccatgcaggtcagcgagaagggcgacctggccaactggatgatcccgggcaag
atggtcaagggcatgggcggcgccatggacctcgtggccggcgtcaagcgcgtgatcgtg
ctcatggaacacgtggcccggaagaaggacgggaccgaggacctgaagatcctgccggcc
tgcacgctgcccctgacgggcgtgggcgtcgtcgatcgcatcatcaccgacctggccgtc
ctggacgtgacgcccgggggtctgaaggtcgtggaactggcgccgggcgtggacttcgat
gcactgcaggcgaagaccggcgtgaagctgctgcccgcctga

KEGG   Acidovorax citrulli: Aave_3127Help
Entry
Aave_3127         CDS       T00451                                 

Definition
(GenBank) 3-oxoacid CoA-transferase, A subunit
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
aav  Acidovorax citrulli
Pathway
aav00072  Synthesis and degradation of ketone bodies
aav00280  Valine, leucine and isoleucine degradation
aav00650  Butanoate metabolism
aav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Aave_3127
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Aave_3127
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Aave_3127
Enzymes [BR:aav01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     Aave_3127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans Mal_decarbox_Al
Motif
Other DBs
NCBI-ProteinID: ABM33691
UniProt: A1TRV3
Position
complement(3450801..3451613)
Genome map
AA seq 270 aa AA seqDB search
MNKLFPSAVEALKGVVADGQLLAVGGFGLCGIPEALIDALRDSGVKGLTVISNNAGVDGF
GLGKLLETRQIKKMISSYVGENKEFERQYLAGELELEFTPQGTLAEKLRAGGAGIPAFFT
RTGVGTIVAEGKELREFDGGTYVMERSLVPDVSLVKAHRADKSGNLQFRLTARNFNPAAA
TAGKLCIVEVEEIVETGEIAPDDVHLPGIYVHRIVHNPNPEKRIEKRTVSAAAPVDAVAA
KVEAQAVIAQAAVAADPVVPTVPANKKEGA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaagcttttcccctccgcggtcgaggcgctcaagggcgtcgtggccgacggccag
ttgctggccgtcggcggtttcgggctctgcggcattcccgaagcgctgatcgacgccctg
cgcgacagcggcgtgaagggcctcaccgtgatttccaacaatgccggcgtggacggcttc
ggcctcggcaagctgctggagacgcggcagatcaaaaagatgatctcctcctacgtgggc
gagaacaaggagttcgagcgccagtacctcgcgggcgagctggaactggagttcacgccc
cagggcacgctggccgagaagctgcgtgccggcggcgcgggcatcccggccttcttcacc
aggaccggtgtcggcaccatcgtggccgagggcaaggagttgcgcgagttcgatggcggg
acctacgtgatggagcgctccctcgtgcccgacgtgtcgctggtcaaggcgcaccgtgcc
gacaagtcgggcaacctgcagttccgcctcacggcgcgcaacttcaatccggcagcggcc
acggcgggcaagctctgcatcgtcgaggtggaagagatcgtcgaaaccggggagatcgca
cccgacgacgtgcacctgcccggcatctacgtgcaccgcatcgtgcacaaccccaaccct
gaaaagcgcatcgaaaaacgcaccgtgagcgccgccgcgcccgtcgatgccgtcgccgcc
aaggtcgaggcccaggccgtgatcgcccaggccgccgtcgcggcagaccccgtggtgccc
accgtacccgccaacaagaaagaaggagcctga

DBGET integrated database retrieval system