KEGG   Acidovorax citrulli: Aave_3247Help
Entry
Aave_3247         CDS       T00451                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aav  Acidovorax citrulli
Pathway
aav00020  Citrate cycle (TCA cycle)
aav00310  Lysine degradation
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
aav01120  Microbial metabolism in diverse environments
aav01130  Biosynthesis of antibiotics
aav01200  Carbon metabolism
Module
aav_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aav_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Aave_3247
  Amino acid metabolism
   00310 Lysine degradation
    Aave_3247
Enzymes [BR:aav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Aave_3247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABM33809
UniProt: A1TS71
Position
complement(3584511..3585794)
Genome map
AA seq 427 aa AA seqDB search
MAIVEVKVPQLSESVAEATMLSWKKKAGEAVAIDEILIEIETDKVVLEVPAPAAGVLAEI
VQGDGATVVADQVIAKIDTEGKAGAAAAPAQSAPTAAAQAPAVAAAAADAAPAAGGSKGD
VAMPAAAKLLADNNLSVSAVSGTGKDGRVTKGDVLAAVAGGAAAKPAAAPGAIPTGVPTK
ALPQVASPAAPNLGDRPEQRVPMSRLRARIAERLLQSQSTNAILTTFNEVNMAPVMELRK
KFQDSFTKEHGTKLGFMSFFVKAAVHALKKFPVLNASVDGNDIVYHGYFDIGIAVGSPRG
LVVPILRNADQMSFADIEKKIAEFGKKAQEGKLGIEEMTGGTFSISNGGTFGSMLSTPII
NPPQSAILGVHATKDRAVVENGQIVVRPMNYLAMSYDHRIIDGREAVLGLVAMKDALEDP
ARLLFDI
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccaactgtccgaatccgtggccgaggccacgatg
ctctcctggaagaagaaggccggcgaggccgtcgccatcgatgagatcctgatcgagatc
gaaaccgacaaggtcgtgctcgaagtgcccgcgccggccgccggcgtgctggccgagatc
gtgcagggcgacggtgccaccgtggtggccgaccaggtcatcgccaagatcgacaccgaa
ggcaaggccggtgccgccgccgcgcccgcgcagtccgccccgaccgccgccgcccaggcg
cccgccgtggccgccgcagcggccgacgccgcccctgccgcgggcggctccaagggtgac
gtggccatgcccgccgccgccaagctgctggccgacaacaacctctccgtctcggccgtg
tccggcaccggcaaggacggccgcgtgaccaagggcgacgtgctggctgccgtggccggc
ggtgctgccgccaagcctgccgccgccccgggcgccatccccacgggcgtgcccaccaag
gcgctgccccaggtggcatcgcccgccgcgccgaacctgggcgaccgccccgagcagcgc
gtgcccatgagccgcctgcgcgcccgcatcgccgagcgcctgctgcagtcgcagtccacc
aacgccatcctgaccaccttcaacgaggtgaacatggccccggtgatggaactgcgcaag
aagttccaggacagcttcaccaaggagcacggcaccaagctgggcttcatgagcttcttc
gtgaaggcggccgtgcacgcgctcaagaagttcccggtgctgaatgcctcggtggacggc
aacgacatcgtctatcacggctacttcgacatcggcatcgccgtcggttcgccccgtggc
ctggtggtgccgatcctgcgcaacgccgaccagatgagcttcgccgacatcgagaagaag
atcgccgagttcggcaagaaggcccaggaaggcaagctcggcatcgaggagatgaccggc
ggcacgttctcgatctccaacggcggcaccttcggctcgatgctgtccacccccatcatc
aacccgccgcaatcggccatcctgggcgtgcacgccaccaaggaccgcgccgtggtggaa
aacggccagatcgtggtgcgcccgatgaactacctggcgatgtcgtacgaccaccgcatc
atcgacggccgcgaagccgtgctgggcctggtggcgatgaaggacgcgctggaagatccg
gcccgcctgctgttcgatatttga

DBGET integrated database retrieval system