KEGG   Acidovorax citrulli: Aave_3578Help
Entry
Aave_3578         CDS       T00451                                 

Definition
(GenBank) non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
aav  Acidovorax citrulli
Pathway
aav00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:aav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Aave_3578
Enzymes [BR:aav01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     Aave_3578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: ABM34129
UniProt: A1TT41
Position
complement(3949880..3950479)
Genome map
AA seq 199 aa AA seqDB search
MKLVLASNNRGKLAELQSMFSPLGVELVRQADLGVGEADEPFHTFVENALAKARFAAEHT
GLPALADDAGLCVDAFGGQPGVQTAYYATRFGYEKGDANNVRALLEQMRGVASRRAAMVS
TLVAVRSPDDPEPLIAVGRVVGEIATEPRGDGGFGFDPVMFIPEFGKTFAELPVEVKNAH
SHRGRSAQQMLALMRERWF
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgtcctcgcatccaacaaccgcggcaagctggccgagctgcagagcatgttc
tctcccctgggcgtggagctggtacggcaggcggatctcggcgtgggcgaggcggacgag
cccttccataccttcgtggagaatgcgctggccaaggcgcgtttcgccgcggagcacacc
gggctgccggcgctggccgacgatgcgggcctgtgcgtggatgccttcgggggacagccg
ggcgtgcagacggcttattacgccacccgtttcggctacgagaagggcgacgcgaacaac
gtgcgtgcgttgctggagcagatgcggggcgtcgcttcgcggcgggcggcgatggtgagt
acgctcgtggccgtgcgcagtcccgacgatccggaacctctcatcgccgtgggccgggtg
gtcggagagatcgccacggagccgcgcggcgacgggggcttcggcttcgatccggtgatg
ttcatcccggagttcggcaagacgttcgccgagttgcccgtggaggtgaagaacgcgcac
agccaccgggggcggtccgcgcagcagatgctcgcgctcatgcgggaacgctggttctga

DBGET integrated database retrieval system