KEGG   Acidovorax citrulli: Aave_4368Help
Entry
Aave_4368         CDS       T00451                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aav  Acidovorax citrulli
Pathway
aav00071  Fatty acid degradation
aav00072  Synthesis and degradation of ketone bodies
aav00280  Valine, leucine and isoleucine degradation
aav00310  Lysine degradation
aav00362  Benzoate degradation
aav00380  Tryptophan metabolism
aav00620  Pyruvate metabolism
aav00630  Glyoxylate and dicarboxylate metabolism
aav00640  Propanoate metabolism
aav00650  Butanoate metabolism
aav00900  Terpenoid backbone biosynthesis
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
aav01120  Microbial metabolism in diverse environments
aav01130  Biosynthesis of antibiotics
aav01200  Carbon metabolism
aav01212  Fatty acid metabolism
aav02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Aave_4368
   00630 Glyoxylate and dicarboxylate metabolism
    Aave_4368
   00640 Propanoate metabolism
    Aave_4368
   00650 Butanoate metabolism
    Aave_4368
  Lipid metabolism
   00071 Fatty acid degradation
    Aave_4368
   00072 Synthesis and degradation of ketone bodies
    Aave_4368
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Aave_4368
   00310 Lysine degradation
    Aave_4368
   00380 Tryptophan metabolism
    Aave_4368
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Aave_4368
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Aave_4368
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Aave_4368
Enzymes [BR:aav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Aave_4368
Exosome [BR:aav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Aave_4368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: ABM34908
UniProt: A1TVC0
Position
complement(4853524..4854708)
Genome map
AA seq 394 aa AA seqDB search
MQQDPIVIIGAARTPMGTFQGDFSGLAAHDLGGVAIRAAVERAGIAPESVGEVLFGNCLM
AGQGQAPARQAGFKGGLPKSAGAVTLSKMCGSGMKAAMFAHDMLLAGTHEVIVAGGMESM
TNAPYLLQKGRGGYRLGHDRIFDHMMLDGLEDAYEPGRSMGTFGEDCAAKYGFTREQQDA
FAVASVQRAKAATESGAFAAEIAPVTVKTRAGETVVSVDEGPGKVRLDKIPALKPAFKKD
GTITAASSSSINDGAAALVMVRESTARRLGAVPIARVAGHAMHAQEPNWFTTAPVGATQK
ALAKAGWSVQDVDLWEVNEAFAVVPMALMKELDVAHDIVNVNGGACALGHPIGASGARII
VTLIHALKARGKRRGLATLCIGGGEGTAMAIELV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaagatcccatcgtcatcatcggtgccgcacgtacgcccatggggactttccag
ggcgatttctcgggcctggctgcccatgacctgggaggcgtggcgatccgtgcggccgtg
gagcgcgcaggcatcgcgccggagagcgtcggcgaggtgctgttcggcaattgcctgatg
gcggggcaggggcaggcgccggcccgacaggccgggttcaagggcgggctgcccaagagc
gccggagccgtcacgttgagcaagatgtgcggttcgggcatgaaggccgcgatgttcgcg
cacgacatgctcctcgcagggacgcacgaagtgatcgtggccggcgggatggagagcatg
acgaatgcgccctatctgctgcagaagggccgcggcggctaccggctgggccacgaccgc
atcttcgaccacatgatgctcgacgggctggaggacgcctacgagcccggacgctcgatg
ggtacgttcggcgaggattgcgcggcgaagtacgggttcacgcgcgagcagcaggatgca
ttcgccgtggcgagcgtgcagcgggcgaaggcggcgaccgaatccggggcgtttgcggcc
gagatcgcaccggtgaccgtgaagacgcgtgccggcgagacggtggtgtcggtggacgag
ggaccgggcaaggtgcggctggacaagattcccgcgctcaagccggcgttcaagaaggac
gggaccatcacggcggcatcgagttcgagcatcaacgacggcgccgcggcgctggtgatg
gtgcgcgagtccacggcccgccgtctcggcgccgtgccgatcgcgcgcgtcgcgggccat
gccatgcatgcgcaggagcccaattggttcaccaccgcgcccgtgggtgccacgcagaag
gcgctggccaaggccggctggagcgtgcaggacgtggacctctgggaggtgaacgaagcc
ttcgcggtggtgcccatggcgctcatgaaggagctggacgtggcgcatgacatcgtgaac
gtgaacggcggagcctgcgcgctggggcacccgatcggagcgagtggggcccgcatcatc
gtgaccctgatccatgccttgaaggcccgtggcaagcggcgcgggctggccacgctgtgc
atcggcggtggcgaaggcacggccatggcgatcgaactggtgtga

DBGET integrated database retrieval system