KEGG   Acidovorax citrulli: Aave_4581Help
Entry
Aave_4581         CDS       T00451                                 

Definition
(GenBank) Pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
aav  Acidovorax citrulli
Pathway
aav00010  Glycolysis / Gluconeogenesis
aav00230  Purine metabolism
aav00620  Pyruvate metabolism
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
aav01120  Microbial metabolism in diverse environments
aav01130  Biosynthesis of antibiotics
aav01200  Carbon metabolism
aav01230  Biosynthesis of amino acids
Module
aav_M00002  Glycolysis, core module involving three-carbon compounds
aav_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
aav_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:aav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aave_4581
   00620 Pyruvate metabolism
    Aave_4581
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Aave_4581
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aav04131]
    Aave_4581
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aav04147]
    Aave_4581
Enzymes [BR:aav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Aave_4581
Membrane trafficking [BR:aav04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Aave_4581
Exosome [BR:aav04147]
 Exosomal proteins
  Proteins found in most exosomes
   Aave_4581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABM35118
UniProt: A1TVY0
Position
complement(5098696..5100132)
Genome map
AA seq 478 aa AA seqDB search
MRIRRATKIVATLGPASSDPVLLERMIAMGVNVVRFNFSHGTAQDHIDRAEKVRAAAQRA
GREVAIMADLQGPKIRVGRFAEGKVWLESGAAFVLDASRTEPGDVAGVGLDYKELPRDVK
PGDVLLLNDGLIVLTVNAVRGEQVLTTVRVGGELSNNKGINKQGGGLTAPALTAKDMEDI
KTAMSFQADYVAVSFPKNATDMEMARQLCNVAAAEFRHKPGLIAKIERAEAVPRLEEILR
VSDGIMVARGDLAVEVGNAAVPALQKKMIRMARDMDKVVITATQMMESMITNPVPTRAEV
SDVANAVLDGTDAVMLSAETAAGRYPLETVEEMAKICAAAEAAEDPERDSDFTGQTLGRI
DQSIAMGALFTAHHLGAKALVALTDSGSTALWMSRHRIHIPIYALTPKVATQRKMAMYRN
VRPLLMDTSVDRDTALEQAESHLKSRNIVQQGDLYVITCGEPMGAPGGTNMLKICRAG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatccgccgagccaccaagatcgtcgccaccctggggcccgcgtcgagcgatccg
gtcctgctggagcggatgatcgccatgggcgtgaacgtggtgcggttcaacttcagccac
ggcacggcgcaggaccacatcgaccgggcagagaaggtgcgggccgcggcccagcgcgcc
ggccgcgaagtcgcgatcatggcggacctgcagggccccaagatccgcgtgggcaggttc
gccgagggcaaggtctggctggagtccggcgctgccttcgtgctcgatgcatcgcgcacc
gagcccggcgacgtggccggcgtgggcctggactacaaggaactgccccgcgacgtgaag
cccggtgacgtgctgctgctcaacgacggcctcatcgtgctcacggtgaacgcggtgcgc
ggcgagcaggtgctcaccactgtgcgcgtgggcggcgagctgtcgaacaacaagggcatc
aacaagcagggcgggggcctcacggcgccggcgctcacggccaaggacatggaggacatc
aagaccgccatgagcttccaggccgactacgtggccgtcagcttccccaagaacgccacc
gacatggaaatggcgcggcagctctgcaacgtggccgccgccgagttccgccacaagccg
ggcctgatcgcgaagatcgagcgcgccgaggccgtgccgcgcctggaagagatcctgcgc
gtgtccgacggcatcatggtcgcgcgcggcgacctggccgtggaggtgggcaatgccgcc
gtgcccgcgctgcagaagaagatgatccgcatggcgcgcgacatggacaaggtcgtcatc
accgccacgcagatgatggagagcatgatcaccaatccggtgcccacgcgcgccgaggtg
agcgacgtggccaacgcggtgctcgacggtaccgacgccgtgatgctcagcgccgagacg
gccgccggccgctatccgctggagacggtggaggaaatggccaagatctgcgccgccgcc
gaggccgccgaggatccggagcgcgattcggatttcacgggccagacgctgggccgcatc
gaccagtccatcgccatgggcgcgctcttcaccgcccaccacctgggcgccaaggccctc
gtggccctgacggacagcggctccacggcgctctggatgagccgccaccgcatccacatc
cccatctacgcgctcacgcccaaagtcgccacccagcgcaagatggccatgtaccgcaac
gtgcggcccctgctgatggataccagcgtggaccgcgacacggcgctggagcaggccgaa
agccacctcaagagccgcaacatcgtgcagcagggcgatctctacgtgatcacctgcgga
gagccgatgggcgcacccggcggaaccaatatgctgaagatctgccgcgccggctga

DBGET integrated database retrieval system