KEGG   Alteromonas addita: AVL56_11440Help
Entry
AVL56_11440       CDS       T04403                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aaw  Alteromonas addita
Pathway
aaw00071  Fatty acid degradation
aaw00072  Synthesis and degradation of ketone bodies
aaw00280  Valine, leucine and isoleucine degradation
aaw00310  Lysine degradation
aaw00362  Benzoate degradation
aaw00380  Tryptophan metabolism
aaw00620  Pyruvate metabolism
aaw00630  Glyoxylate and dicarboxylate metabolism
aaw00640  Propanoate metabolism
aaw00650  Butanoate metabolism
aaw00900  Terpenoid backbone biosynthesis
aaw01100  Metabolic pathways
aaw01110  Biosynthesis of secondary metabolites
aaw01120  Microbial metabolism in diverse environments
aaw01130  Biosynthesis of antibiotics
aaw01200  Carbon metabolism
aaw01212  Fatty acid metabolism
aaw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aaw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AVL56_11440
   00630 Glyoxylate and dicarboxylate metabolism
    AVL56_11440
   00640 Propanoate metabolism
    AVL56_11440
   00650 Butanoate metabolism
    AVL56_11440
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AVL56_11440
   00072 Synthesis and degradation of ketone bodies
    AVL56_11440
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AVL56_11440
   00310 Lysine degradation
    AVL56_11440
   00380 Tryptophan metabolism
    AVL56_11440
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AVL56_11440
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AVL56_11440
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AVL56_11440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aaw04147]
    AVL56_11440
Enzymes [BR:aaw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AVL56_11440
Exosome [BR:aaw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AVL56_11440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AMJ94845
Position
complement(2680437..2681618)
Genome map
AA seq 393 aa AA seqDB search
MRDAVIVSTARTPIGRAYKGALNNLPAPTLGGHAIRNAVQRAGVDPASIDDVIMGAALTQ
GSGGMNIGRLAALAGDLPVTVAGMTLDRQCSSGMYAIANAANSIRTGDTNIMVAGGLDSI
SLVQTKAMNMSRAVDPQLVAKHKNIYMPMLQTAEVVAQRYGISRDVQDEYAYQSQMRTAA
GQEAGKFDDEIVPITATKAIFNKETGETSEQEVTLSKDEGNRPETQLEGLRSLKPVIEGG
CITAGNASQLSDGASATVIMDEQSAAKGQAQPLGIYRGIAVAGCEPDEMGIGPVFAIPKL
LKQHGLTMDDIGLWELNEAFAVQVLYCRDKLGIPDELLNVNGGAISIGHPYGMSGARMVG
HALIEGKRRGAKYVVCTMCIGGGMGAAGLFEVI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatgcagtaatagtaagtaccgcaagaacgcctattggccgtgcctataaaggt
gcactaaataatttaccagcccctacattaggtggtcatgctattcgcaacgcggtacaa
cgtgcaggtgttgatcctgccagtatcgacgatgtgatcatgggtgcagccctaacgcaa
ggcagtggcggcatgaacataggtcgcttagcggcattagcaggcgatttgccggtgact
gttgctggcatgacgttagacagacaatgtagctctggcatgtatgccattgccaatgcg
gcaaacagtattcgtactggcgacaccaatattatggtagcgggtgggttagattctatt
tctttggttcaaaccaaagccatgaacatgtctcgcgcggttgacccacaactagtggca
aagcataagaacatttatatgcctatgctgcaaactgctgaagttgttgcacagcgctac
ggtattagccgtgacgtgcaagatgaatacgcttatcaaagccaaatgcgcacagcggca
ggccaagaagcaggcaagtttgacgacgaaattgtgccaattacggccactaaagccatt
ttcaataaagaaactggtgaaacaagcgagcaggaagtgacgttatcgaaagacgaaggt
aaccgtcctgaaactcaacttgaaggtttgcgttcgctgaaacctgtgattgaaggcggt
tgtattactgcgggtaatgcgagtcaactgtctgatggtgctagtgctaccgtcattatg
gatgagcaatctgccgctaaaggtcaagcgcaaccattaggtatttaccgtggtattgcg
gtagctggatgtgaacctgatgaaatgggtattggccctgtatttgctattcctaaattg
ttaaagcaacacggcttaaccatggacgatattggtttgtgggaacttaacgaagccttt
gctgttcaagtgctttattgccgcgacaagctgggtattcctgatgaattactaaacgta
aacggtggtgcaatttcaattggtcacccttacggaatgagtggcgcacgtatggtgggt
catgcattaatcgagggcaaacgacgtggtgctaaatacgttgtttgtactatgtgtatt
ggcggcggtatgggtgctgctggtttatttgaagttatatag

DBGET integrated database retrieval system