KEGG   Alteromonas addita: AVL56_13880Help
Entry
AVL56_13880       CDS       T04403                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
aaw  Alteromonas addita
Pathway
aaw00620  Pyruvate metabolism
aaw00630  Glyoxylate and dicarboxylate metabolism
aaw01100  Metabolic pathways
aaw01110  Biosynthesis of secondary metabolites
aaw01120  Microbial metabolism in diverse environments
aaw01200  Carbon metabolism
Module
aaw_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aaw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AVL56_13880
   00630 Glyoxylate and dicarboxylate metabolism
    AVL56_13880
Enzymes [BR:aaw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AVL56_13880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AMJ95281
Position
3226228..3228405
Genome map
AA seq 725 aa AA seqDB search
MQNYITRGRLQVAEQLDDFINQQAMPGTGVQPDAFWQGAEALFSEFVPQNRALLEKREQL
QLAIDNYHKAGNPAFGEQYITFLKEIGYLVEQPETVQADTTNVDAEIATMAGPQLVVPIN
NARYALNAVNARWGSLYDALYGTDVISDENGAEPGKNYNPVRGEKVVAKAKAYLDNMLPL
AKGSHADVTGYKIETGKLAISLTDGDITTLANTEQWQGYQGDITAPTALLFIHNGLHFEI
QIDITSPIGKTDAAGVKDVLIEAALTTIMDCEDSVAAVDAEDKTLVYSNWLGLMKGSLSI
EMNKGGKTIVRAMHEDRVYSPSKHVTNQEQLSLSARSLMFVRNVGHLMTNDAMLFDGEPV
PEGIMDGLVTSLIAKHDLLNNSPFQNSRHGSIYIVKPKMHGPEEVAFSDALFAKIETVIN
VPKNTLKMGIMDEERRTSVNLDACINAAKSRVVFINTGFLDRTGDEIHTSMLAGAFAEKA
TLKTMPWIKAYETANVAVGLRCGLSGKAQIGKGMWPIPDEMQNMMDAKIGHPKSGANTAW
VPSPTAATLHALHYHDVNVFDIQKGLNERFSGLNDILTIPLLESKDSLSADTIQREIDNN
VQGILGYVVRWVHQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLEHGIVSAAQVDES
LRRMAKLVDEQNAGDAEYIPMMPDLDSSIGFLAASDLIFKGKEQPSGYTEPLLHARRREM
KAKLV
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaattatattacacgaggccgtttacaggttgctgagcaactcgatgacttcatc
aaccaacaggcaatgccaggcactggtgttcagccagacgcattttggcaaggtgcagaa
gccctcttttcagaatttgttcctcaaaatcgtgccctgctagaaaaacgagaacaactc
caactcgctatcgataactatcacaaagcgggaaaccccgctttcggtgagcagtacatt
actttcctaaaagaaattggttatctagtagaacagcctgaaacggtgcaagccgatacc
acaaacgtggatgcagaaattgctaccatggctggccctcaattagtggtaccaattaac
aacgcccgctatgcattaaatgctgttaatgcccgctggggtagtttgtacgatgctttg
tacggcactgatgttattagcgatgagaacggggcagaacccggcaaaaactataaccct
gtgcgtggcgagaaagtggtagcgaaagcgaaagcctacttagacaatatgcttccactt
gcgaagggaagtcacgcagatgttaccggttataaaattgaaaccggcaaattagcgatt
tcgttaaccgacggtgacatcaccacacttgcgaacaccgagcaatggcaaggttaccaa
ggtgatataactgctcccactgcgctgttgtttattcacaacggcctgcactttgaaatt
cagatagatatcactagccctattggtaaaactgacgccgctggcgtgaaagatgtgtta
attgaagccgcgctcactaccattatggattgcgaagactcagtcgccgctgttgatgcc
gaagacaaaaccctggtgtacagcaactggctggggctaatgaaaggctctttaagcatt
gaaatgaacaaaggtggcaaaaccatcgttcgcgccatgcatgaagatagggtgtactcg
ccttcaaaacatgtaacgaaccaggagcaattgtctttatccgcgcgcagccttatgttt
gtgcgtaacgtaggtcatctaatgacaaacgacgctatgctatttgatggtgagccagta
ccagaaggtattatggacggtttagtgacttcgctcatcgccaagcatgatttactgaat
aatagcccattccaaaattctcgtcatggcagcatttatattgttaaacccaaaatgcat
ggccctgaagaagtggccttttctgatgccttatttgccaagattgaaaccgttatcaat
gtgcctaaaaacacattgaaaatgggtattatggatgaagaacgccgcaccagtgtgaac
ctagacgcttgtatcaatgcagcgaagtctcgtgttgtatttattaataccggcttctta
gacagaacaggcgatgaaattcatacgtctatgcttgcaggagccttcgccgagaaagcg
acccttaagaccatgccttggattaaagcgtatgaaaccgcaaatgtagcggtcggcctt
cgctgtggtctttctggtaaggcacaaattggtaaaggcatgtggcctattcccgatgaa
atgcaaaatatgatggatgccaaaattggacatccaaaatctggcgcgaataccgcttgg
gttccctcacctaccgctgccactttgcacgctctgcattaccatgatgtaaatgttttc
gacattcaaaaaggattaaatgagcgtttctcaggccttaacgatatcttgactattccg
ctgctagaaagcaaagattcactgtcagccgataccatacagcgcgaaatagataataat
gtgcaaggtatattaggttatgtggtccgttgggtgcatcaaggtgtaggctgctctaaa
gtgccagatattaacaatgttggactgatggaagacagggccacactacgtatttcatca
cagcatattgcaaattggcttgagcacggcattgtaagtgcagcgcaagttgatgaatca
cttcgccgtatggcaaagctagtggatgagcaaaatgctggcgacgcagaatatatcccc
atgatgccggacttagatagctcaattggtttcttagccgctagcgatcttatctttaaa
gggaaggaacagccaagtggttatacagagccattactgcacgcgagacgccgtgagatg
aaggcgaaattagtctag

DBGET integrated database retrieval system