KEGG   Alteromonas addita: AVL56_17320Help
Entry
AVL56_17320       CDS       T04403                                 

Definition
(GenBank) aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
aaw  Alteromonas addita
Pathway
aaw00360  Phenylalanine metabolism
aaw00362  Benzoate degradation
aaw01100  Metabolic pathways
aaw01120  Microbial metabolism in diverse environments
aaw01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aaw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AVL56_17320
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AVL56_17320
   00622 Xylene degradation
    AVL56_17320
   00621 Dioxin degradation
    AVL56_17320
Enzymes [BR:aaw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     AVL56_17320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like MAF_flag10
Motif
Other DBs
NCBI-ProteinID: AMJ95895
Position
4068201..4069805
Genome map
AA seq 534 aa AA seqDB search
MNIVIVLDCTLRDGGYYNSWNFPQHVVEQYLQAMEAANVNIVELGMRSLKNEGFKGAAGF
TTEDYLDTLPIPTSLKVGVMVNASELASAPSLEEALDSLFPKDADKSKVDLVRIACHVHE
FEQALPACVWLKERGFLVGFNLMQVAERSQTEVEALALAASKYDIDALYFADSMGSMGPE
QCKTIITWFKKHWNGAIGIHTHDNMGKALQNTLTAIEEGVTWLDATVTGMGRGPGNARTE
ELVIEVAALQGKNVNLVPLMAIIRSYFQPLKNKCGWGSNPFYFLSGKYGIHPTFIQEMLS
DPRYSEEDILAAIEHLRVEGGSKFSFNTLDATRNFFKEKGKGAWSPKSQILGKSVLILGA
GPGLKQHTSAIQAFIEKHSPVVIAMNAQSTLPEELVDLRIASHPVRLLADCQHHLVLPQP
LITPASALPDDVTDSLQDKTLYDFALEVSENTFTIGETSASIPNSLAISYALAVAAAGSA
KHVYLAGFDGFGSGDNRTQEMQKVLNAFIEQVKLPITSITYTEYDIPSISVYGV
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
attaatatagtgatagttcttgattgcacactacgtgatggcggttattataatagttgg
aatttcccccagcacgtggtggaacaatatctacaggcaatggaagcagctaacgttaat
attgtcgaacttggtatgcgctctttaaaaaacgaaggtttcaaaggcgctgctggcttt
actaccgaggattatctagatacgttgcccataccaacctcactaaaagttggcgtgatg
gttaatgcatctgaattagctagcgcaccctctctagaagaagcacttgactcacttttc
cctaaagatgctgacaaatcaaaagtcgatttagtaagaattgcttgtcatgtccatgaa
tttgagcaagctttgccagcgtgcgtgtggctaaaagaaagagggttcttagtcgggttt
aatttaatgcaggttgctgaacgctctcaaactgaggttgaagcgctagcattggcagct
tcgaaatatgatatcgacgctttatactttgccgattcaatggggagcatgggacctgaa
caatgcaaaactatcatcacatggtttaaaaagcattggaatggcgctattggtattcat
acgcacgacaatatgggtaaagcactacaaaacacccttacggctattgaagaaggcgtg
acttggctagatgctacagttacgggcatgggacgcgggcctggtaacgcaagaacagaa
gagcttgttattgaggtagctgctttacagggaaaaaatgttaacttagtcccgttaatg
gctattattcgttcatatttccaaccactcaaaaacaaatgtggctggggctcgaaccca
ttttatttcctctctggaaaatatggtattcatccgacttttattcaagaaatgcttagc
gatcctcggtacagtgaagaagatatattggccgctattgagcatcttagggttgagggc
ggctcaaagtttagtttcaatacactcgatgccactagaaacttctttaaagaaaaaggt
aaaggtgcgtggtctcccaaaagccaaatccttggaaaatcagttctaattcttggagcg
ggtccaggattaaagcagcacacgtcggcaattcaagcatttattgaaaagcactcccct
gttgttattgctatgaatgctcaaagcacgctaccagaagagttggtcgatttgagaatc
gctagccacccagttcgcttacttgctgattgtcagcatcacttagtgttaccacaacca
ctgataacgcctgcttcggctttacctgatgatgttaccgactcactccaagacaaaact
ctttatgattttgctttggaagttagcgaaaacactttcactataggtgaaacttcagca
tcaataccaaactctctagctataagctatgcactagctgttgctgctgcaggatctgct
aaacatgtttatttagctgggtttgatggtttcggctcaggcgataacagaacgcaagaa
atgcaaaaagtgttaaatgcatttattgaacaggtaaagttacccataacttcaattacc
tataccgaatacgatattccatcgatctcagtttatggtgtctaa

DBGET integrated database retrieval system