KEGG   Alteromonas addita: AVL56_17360Help
Entry
AVL56_17360       CDS       T04403                                 

Gene name
cpsB
Definition
(GenBank) mannose-1-phosphate guanyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
aaw  Alteromonas addita
Pathway
aaw00051  Fructose and mannose metabolism
aaw00520  Amino sugar and nucleotide sugar metabolism
aaw01100  Metabolic pathways
aaw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aaw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AVL56_17360 (cpsB)
   00520 Amino sugar and nucleotide sugar metabolism
    AVL56_17360 (cpsB)
Enzymes [BR:aaw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     AVL56_17360 (cpsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 Vps16_N AraC_binding
Motif
Other DBs
NCBI-ProteinID: AMJ95903
Position
complement(4079204..4080610)
Genome map
AA seq 468 aa AA seqDB search
MKPVVLAGGTGSRLWPKSRAALPKQFLSLTSDNTMLQDTIVRLKGTKAQSPIFICNDAHR
FLVAEQLRQKDIHHGGILLEPVGRNTAPAIALAALHATMNGEDPVLLVLAADHLIKDEPA
FHAAIEKAEKLAEQGKLVTFGIVPDQPHTGYGYIKAGSGLADGFEVAEFVEKPALETAKG
YVNSGDYFWNSGMFMFKASRYLEELEKYSPEMLDVCKRAIDTETPDLDFIRVDHDIFATC
PDDSIDYAVMEKTDSAAMVPLDAQWSDVGSWTSLWETAEKDENGNVSVGDTILENTKNSY
VNAEQRLVSVIGLEDVIVVETKDAVMVAHKDDAQSIKNVVNKLKAEKRPEFQFHREVFRP
WGSYDSIDNGARFQVKRITVKPGEKLSVQMHHHRAEHWIVVSGSANVTIDDKTTLVTENQ
SVYIPIGAVHALENPGKIQLELIEVQSGAYLGEDDIVRFSDRYGRVAK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagtagtacttgcaggcggcactggaagccgcttatggccaaaatcaagagcg
gcgttacctaaacagtttttgtcactcacatccgataacaccatgttgcaagacactatt
gttcggttgaaaggtactaaagcccaaagccccatttttatatgtaatgatgcacaccga
tttctagttgcagagcaactacgtcaaaaagacattcaccatggcggtattttacttgag
cctgttggccgaaatactgcaccggctattgcactagcagcgttgcatgcaacgatgaat
ggtgaagaccctgttttgctcgtactagcagccgaccatttaattaaagacgaacccgca
tttcatgctgcaattgaaaaagcagaaaaattagcagagcagggtaaattggtgacattt
ggtatagtgccagatcaaccacacacgggctatggctacattaaagcaggaagtggattg
gcagatggatttgaagtggcggagtttgttgagaaacctgcgcttgaaactgcaaaaggg
tatgtaaattctggtgactatttttggaatagtggcatgtttatgtttaaagctagcaga
tacctagaagagcttgagaaatacagccctgaaatgctagatgtctgtaaacgcgccatt
gacactgaaaccccagacctagattttattcgcgtcgatcacgatatttttgctacctgc
ccagatgactctatcgattatgctgtaatggaaaaaactgatagtgctgccatggttcca
cttgatgcccagtggagtgatgtaggtagctggacttcgttatgggaaacagcggaaaaa
gacgaaaatggcaatgtttctgttggtgatactattttagaaaatactaaaaatagctat
gtgaacgcagagcaacgccttgtatctgtcattggtttggaagacgttatagtcgtagaa
actaaagatgcggttatggtcgctcataaagacgatgcacagagcatcaagaacgtggta
aacaaacttaaagctgaaaaacgccctgaatttcagttccatcgtgaagtatttcgccct
tggggcagttacgattcaattgataatggggctcgtttccaagttaagagaattactgtt
aagcctggcgaaaaactgtcggttcaaatgcaccatcaccgcgctgaacactggatcgtg
gtatcgggcagtgccaatgtaaccatagatgataaaactacattagtcaccgagaaccaa
tcggtttacattcctataggggctgttcatgccctagaaaatccgggtaagatccaactg
gagcttattgaagtgcagtcaggcgcctatttaggcgaagatgacatagtgcgcttttct
gatagatatggacgtgtagctaagtaa

DBGET integrated database retrieval system