KEGG   Alteromonas addita: AVL56_19130Help
Entry
AVL56_19130       CDS       T04403                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
aaw  Alteromonas addita
Pathway
aaw00010  Glycolysis / Gluconeogenesis
aaw00020  Citrate cycle (TCA cycle)
aaw00620  Pyruvate metabolism
aaw01100  Metabolic pathways
aaw01110  Biosynthesis of secondary metabolites
aaw01120  Microbial metabolism in diverse environments
aaw01130  Biosynthesis of antibiotics
aaw01200  Carbon metabolism
Module
aaw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aaw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AVL56_19130
   00020 Citrate cycle (TCA cycle)
    AVL56_19130
   00620 Pyruvate metabolism
    AVL56_19130
Enzymes [BR:aaw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     AVL56_19130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_29 AAA_33 DUF4358 AAA_16
Motif
Other DBs
NCBI-ProteinID: AMJ96217
Position
complement(4485429..4486991)
Genome map
AA seq 520 aa AA seqDB search
MSAAASLKTDLKISPLVDLPSAELIERAIKRGEGVLDTNGALVVETGERTGRSPNDRFIV
KESSTENEIDWGKVNKPFDANKFDALWNKVEAYLTTQEHFLSHLQVGSDPAHALPLEVRT
QTAWQHVFARNLFIVPENWNSNNESPWQVLNVPGFVCEPERDGTNSDGVVVINFAKKRVL
IAGMRYAGEMKKAMFSVQNFLLPAKDILPMHCSANVGEQGDVTLFFGLSGTGKTTLSADP
KRFLIGDDEHGWGEGSVFNIEGGCYAKCIDLSQKNEPVIWDAIKFGTILENVVLDDSRTP
DYKDTSLTQNSRAAYPLSHIEKRVEANRGGEPRSVVFLTCDVSGVLPPVSVLSEEAAAYH
FLSGYTAKVGSTEIGSTSDIESTFSTCFGAPFFPRPAGVYAELLIKRVKAFNAKVYLVNT
GWTGGPYGTGQRFDIPTTRAIIDAIVSGDLADVETQHIEGLNLDVPVAVSGVDDNLLVPK
KTWDDAEKYEEYAQNLVDSFKQNFEKYDVSDAIVKAGPGN
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagcagcgtctttgaaaacggatttaaaaatctctccgctggttgatttgccc
agcgccgagttaatcgaacgcgcgattaagcgtggcgagggtgtgttagacactaacggg
gctttggtggttgaaaccggcgaaagaaccggtcgctcaccaaatgataggtttatcgtt
aaagagtcttctactgaaaatgaaattgattggggcaaggttaataagccatttgatgcc
aataaattcgatgccttgtggaataaagtagaggcctaccttactacccaagagcatttt
ctgtctcatcttcaagtaggctcagatccggctcatgcacttcctttagaagtaagaacg
caaactgcatggcagcacgtgtttgcccgtaatctttttatcgtacctgaaaactggaat
tcgaataacgaaagtccttggcaagtattgaacgttccaggcttcgtttgtgagccagag
cgtgacggcaccaacagtgatggtgttgtagtcattaattttgctaaaaagcgggtgctt
attgctggcatgagatacgccggtgaaatgaaaaaggctatgttttcggttcagaacttc
ttactacccgccaaagacatattacctatgcattgctctgctaacgttggcgagcaaggc
gatgttacgttgttctttggtttgtcgggaaccggtaaaaccaccttatctgccgatcct
aagcgctttttaattggtgatgatgaacacggttggggcgaaggcagtgtgtttaatatt
gagggcggctgctacgcaaaatgtatcgacctttcgcaaaaaaacgaaccggttatttgg
gatgcgattaagtttggcactattttagaaaacgttgtgttagatgatagccgcacccct
gattacaaagatacttcgctaacacaaaattcaagagctgcttatccgttaagccatatc
gaaaaacgcgttgaagcaaaccgtggcggcgagccacgctctgtcgtgtttttaacctgt
gacgtaagtggtgtgttaccgccagtgtcagtgctaagtgaagaagctgcggcctatcat
ttcttaagtggttacaccgcgaaggtaggctctacagagattggttcaacctctgacatt
gaatcgaccttctctacttgctttggcgcacccttcttcccacgcccagctggcgtgtat
gctgagttattaattaaacgtgtgaaagcgtttaatgccaaagtgtacttggtgaatacc
ggttggactggtgggccttatggtacaggtcagcgttttgatattcctactacccgcgcc
attatcgatgccattgtatctggtgatttagccgatgttgaaacccaacatattgaaggc
ctaaaccttgatgtacctgttgcagtatcgggcgttgacgataacttattagtgcctaag
aaaacctgggatgatgcagaaaaatacgaagaatatgcgcagaacctagtagatagcttc
aagcagaattttgaaaaatacgatgttagtgacgccattgttaaggctggtcctggcaac
taa

DBGET integrated database retrieval system