KEGG   Altererythrobacter atlanticus: WYH_00538Help
Entry
WYH_00538         CDS       T03925                                 

Gene name
cat1
Definition
(GenBank) Succinyl-CoA:coenzyme A transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
aay  Altererythrobacter atlanticus
Pathway
aay00020  Citrate cycle (TCA cycle)
aay00620  Pyruvate metabolism
aay00650  Butanoate metabolism
aay01100  Metabolic pathways
aay01110  Biosynthesis of secondary metabolites
aay01120  Microbial metabolism in diverse environments
aay01130  Biosynthesis of antibiotics
aay01200  Carbon metabolism
Module
aay_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aay_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WYH_00538 (cat1)
   00620 Pyruvate metabolism
    WYH_00538 (cat1)
   00650 Butanoate metabolism
    WYH_00538 (cat1)
Enzymes [BR:aay01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     WYH_00538 (cat1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans CitF LUD_dom
Motif
Other DBs
NCBI-ProteinID: AKH41597
UniProt: A0A0F7KQY3
Position
complement(552842..554332)
Genome map
AA seq 496 aa AA seqDB search
MYRERVRNAALLERITSADEAAKLIRDGMTVGMSGFTRAGEAKAVPMALAERAKTDPLKI
TLITGASLGNDLDKTMAEAHLLARRIPFQADPALRRAINDGEVMFVDQHLSETVEMLRTR
QLGPVDVAVIEAVAITEDGGIVPTTSVGNSASFAILADKVIVEINLAQPDTLEGLHDIYI
PSYRPARMPIPIVSPESRVGMPYIPIDPDKIAAIVVTEKLDSSSTILPPDEDTQAIAGHL
SEFLQHEVKAGRLTNTLQPLQAGIGTIANAVMHGLIDTPFHNLKMYSEVLQDSTFDLFDA
GKLDFASGSSITVSAERYQTVLEDLARYKSRLVLRPQEISNHPEVVRRLGIIGINTALEF
DIYGNVNSTHVGGTKMMNGIGGSGDFARNGYMSIFVTKSTAKDDVISSVVPMVSHVDHNE
HDVDVLITEYGLADLRGLAPRERAPLIIANCVHPAYREQLGDYYRRAVARGGHTPHVIEE
ALSWHGRLRETGSMKI
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgtgaacgggtacgcaatgcagcgcttcttgaaaggatcaccagcgcggatgaa
gccgcgaagctgatccgcgacggcatgactgtcggcatgagtggtttcactcgtgccggg
gaagccaaggccgtgccgatggcactggccgaacgggcaaagaccgatcctctcaagatc
acgctgatcaccggggcctcgctcggaaacgatctcgacaagaccatggccgaagcgcac
ctgctcgcgcggcgtatccccttccaggccgatcccgcactacgcagggcgatcaatgat
ggcgaggtgatgttcgtagatcagcatctctccgaaacggttgaaatgctgcgcacccgc
cagctcggcccggtggacgtcgcggtgatcgaggcggtcgctatcaccgaggatggcggt
atcgtgccgaccacctcggtgggcaattcggccagcttcgcgattctggccgacaaggtg
atcgtggaaatcaatctggcccagcccgacacgctggagggcctgcacgatatctatatc
ccgtcctaccgccctgcccggatgccgatcccgatcgtctcgcccgaaagccgggtgggt
atgccctatataccgatcgatccggacaagatcgccgccatcgtggtgacggaaaagctt
gattcctcctctaccattctgccgccggacgaagacacgcaggcgatcgccggccacctt
tcggaattcctgcagcacgaagtgaaagcggggcgtctcaccaacactttgcagccattg
caggcgggcatcggcacgattgccaatgccgtgatgcatggcctcatcgataccccgttt
cacaatctgaagatgtattccgaagttcttcaggattctaccttcgacctgttcgatgcc
ggcaagctggatttcgcttccggttcgtcgatcaccgtttccgcggaacgataccagacg
gtgctggaagatctcgcgcgctacaaatcacgcttggtcctgcgccctcaggaaatctcc
aaccatcccgaagtcgtacgccggctcgggatcatcggtatcaacaccgccctggaattc
gacatatatggcaatgtaaattccacccatgtcggcggcacgaagatgatgaacggcatc
ggcgggtccggcgactttgcgcgaaatggctatatgtcgatcttcgtcaccaaatcgacc
gccaaggacgacgtgatttccagcgtggtgccgatggtcagccatgtcgatcacaatgaa
catgatgtcgatgtgctgatcaccgaatacggccttgccgatctgcgcggtcttgcaccg
agagagcgtgcgccgctgatcatcgccaattgcgtccacccggcctatcgcgaacagctt
ggcgattactaccgcagggccgtggcgcgtggcgggcatacaccgcacgttattgaagag
gcgctgtcctggcatggccgcctgcgcgaaacgggcagcatgaagatatag

DBGET integrated database retrieval system