KEGG   Altererythrobacter atlanticus: WYH_00636Help
Entry
WYH_00636         CDS       T03925                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aay  Altererythrobacter atlanticus
Pathway
aay00071  Fatty acid degradation
aay00072  Synthesis and degradation of ketone bodies
aay00280  Valine, leucine and isoleucine degradation
aay00310  Lysine degradation
aay00362  Benzoate degradation
aay00380  Tryptophan metabolism
aay00620  Pyruvate metabolism
aay00630  Glyoxylate and dicarboxylate metabolism
aay00640  Propanoate metabolism
aay00650  Butanoate metabolism
aay00900  Terpenoid backbone biosynthesis
aay01100  Metabolic pathways
aay01110  Biosynthesis of secondary metabolites
aay01120  Microbial metabolism in diverse environments
aay01130  Biosynthesis of antibiotics
aay01200  Carbon metabolism
aay01212  Fatty acid metabolism
aay02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    WYH_00636 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    WYH_00636 (thlA)
   00640 Propanoate metabolism
    WYH_00636 (thlA)
   00650 Butanoate metabolism
    WYH_00636 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    WYH_00636 (thlA)
   00072 Synthesis and degradation of ketone bodies
    WYH_00636 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WYH_00636 (thlA)
   00310 Lysine degradation
    WYH_00636 (thlA)
   00380 Tryptophan metabolism
    WYH_00636 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WYH_00636 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WYH_00636 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WYH_00636 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aay04147]
    WYH_00636 (thlA)
Enzymes [BR:aay01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WYH_00636 (thlA)
Exosome [BR:aay04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WYH_00636 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AKH41692
UniProt: A0A0F7KR82
Position
655644..656840
Genome map
AA seq 398 aa AA seqDB search
MAIFNESDPIVILSYARTPMGAMQGALAEVSATDLGATAVKGAVERAGISGDEFDRIYMG
CVLPAGLGQAPARQAGVKAGLPKSVQATTVNKVCGSGMQTVIMGAEALASGAADFIVAGG
MESMTNAPYLLKKHRSGARLGHDTAYDHMFLDGLEDAYDAGAAMGSFAQETANEYKLTRE
EMDEFSIESLSRANAAIESGAFKDEIVPVTYSTRKGEVTVDTDEQPGRGRPDKIPQLRAA
FAKDGTITAATSSSISDGAAALVLTRSSVAKDKGFAPVATIVGTAAHAQEPKAFTTAPVG
AIHTLLEKTGWSMDEVDLFEINEAFACVAMFAMRDLGIPHEKINVNGGATALGHPIGASG
ARILVTLIAALKARGGKKGIASLCIGGGEATAIAVEIA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggccattttcaacgaatccgatcctatcgtcatcctgtcctacgcccgcacgccgatg
ggcgccatgcagggcgcgcttgcagaggtgagcgcgaccgacctgggcgccaccgccgtg
aagggcgcggtcgaacgggccggaatttccggtgatgaattcgaccgcatctatatgggc
tgcgtgctgcccgcaggccttggacaggcacccgcgcgccaggccggtgtcaaggcgggc
ctgccaaaatccgtccaggcgacgactgtgaacaaggtctgcggcagcggcatgcaaacg
gtcattatgggggccgaagcgctggcatccggcgccgccgatttcatcgtcgccggcggt
atggagagcatgacgaatgcgccctatctgctcaagaagcatcgttcaggcgcgcggctt
ggccatgacacggcttacgatcacatgttcctggacgggctggaagatgcttacgatgcg
ggggccgcaatgggttccttcgcgcaggaaacggcgaacgagtacaagctgacgcgcgag
gagatggacgaattttccatcgaatcgctttcccgcgcaaatgcggcgatcgaaagcggc
gccttcaaggacgagatcgttccggtcacctattccacccgcaagggcgaagttacggtg
gatacggatgaacagcccggacgcggacgcccggacaagatcccgcaattgcgtgccgcc
tttgcaaaggatggcacgatcaccgcagccacctcatcgtctatttccgatggtgccgcc
gcactggtgctgacgcgttccagtgtcgccaaggataagggctttgcgcctgtcgccacg
attgtgggcacggcggcccatgcgcaggaaccgaaggccttcaccaccgcacctgtcggc
gcgatccataccctgctggagaagacgggctggagcatggatgaggtcgacctgttcgag
atcaacgaagccttcgcctgcgttgccatgttcgccatgcgcgatctcggcatcccgcat
gaaaagatcaatgtgaatggcggcgccacggcgctgggccatcccatcggcgccagcggt
gcgcgcatcctggtaacactcatcgcggcattgaaggcacgcggtggcaagaagggtatt
gccagcctctgcattggcggcggcgaagcaaccgcgatcgcggtcgagatcgcctga

DBGET integrated database retrieval system