KEGG   Altererythrobacter atlanticus: WYH_01160Help
Entry
WYH_01160         CDS       T03925                                 

Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
aay  Altererythrobacter atlanticus
Brite
KEGG Orthology (KO) [BR:aay00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    WYH_01160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 YwhD Chitin_bind_4
Motif
Other DBs
NCBI-ProteinID: AKH42206
UniProt: A0A0F7KSU1
Position
complement(1216596..1217009)
Genome map
AA seq 137 aa AA seqDB search
MANVLSSLFQHTAITAGVTVRVAVNFMPEQSRVEAGRWFWVYHIRIENHRDDKVQLRSRH
WRITDGRGMVNIVDGEGVVGETPLLAPGQTHDYVSGCELTTHQGSMEGHYTFVQEDGELF
EVSIPFFPLAAPAPANR
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgtactctccagcctgttccagcatacggcgataacagccggggtcaccgtt
cgggtggccgtgaacttcatgccggaacaatcccgggttgaagcggggcggtggttctgg
gtctatcatatcaggatagaaaaccaccgggacgacaaggtgcaattgcgcagccgccat
tggcgcatcaccgatgggcgcggcatggtgaatatcgtcgatggcgagggggtggtgggc
gaaacgccgctgctggcaccgggccagacgcatgattacgtgtccggctgtgaactgacg
acccaccaagggtccatggaagggcactacactttcgtccaggaagacggcgaattgttt
gaagtgtcgatacccttcttccccctggcagcgcccgcgccggccaaccgctga

DBGET integrated database retrieval system